KEGG   Bacillus subtilis subsp. subtilis 168: BSU32550
Entry
BSU32550          CDS       T00010                                 

Gene name
yurJ
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K10112  multiple sugar transport system ATP-binding protein [EC:7.5.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU32550 (yurJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32550 (yurJ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    BSU32550 (yurJ)
   Maltose transporter
    BSU32550 (yurJ)
   Arabinogalactan oligomer/maltooligosaccharide transport system
    BSU32550 (yurJ)
   Raffinose/stachyose/melibiose transporter
    BSU32550 (yurJ)
   Alpha-glucoside transporter
    BSU32550 (yurJ)
   Glucose/mannose transporter
    BSU32550 (yurJ)
   Trehalose/maltose transporter
    BSU32550 (yurJ)
   Cellobiose transporter
    BSU32550 (yurJ)
   N,N'-Diacetylchitobiose transporter
    BSU32550 (yurJ)
   L-Arabinose/D-xylose transporter
    BSU32550 (yurJ)
   Putative fructooligosaccharide transporter
    BSU32550 (yurJ)
   Putative sorbitol/mannitol transporter
    BSU32550 (yurJ)
   Arabinooligosaccharide transporter
    BSU32550 (yurJ)
   Putative multiple sugar transporter
    BSU32550 (yurJ)
SSDB
Motif
Pfam: ABC_tran OB_MalK TOBE_2 Rad17 AAA_21 TOBE SMC_N AAA_22 AAA_16 CysA_C_terminal RsgA_GTPase Zeta_toxin AAA AAA_23 AAA_29 AAA_14 AAA_18 AAA_33 AAA_30 AAA_28 AAA_15
Other DBs
NCBI-GeneID: 937070
NCBI-ProteinID: NP_391135
Pasteur: BG13996
BSORF: BG13996
UniProt: O32151 A0A6M4JN00
Position
complement(3345013..3346116)
AA seq 367 aa
MASLTFEHVKKSYHSQLTVKDFDLDVKDKELLVLVGPSGCGKSTTLRMVAGLESISEGNL
LIDGERVNDLPPKERDIAMVFQNYALYPHMTVFDNMAFGLKLRKMAKQEIAERVHAAARI
LEIEHLLKRKPKALSGGQRQRVALGRSIVREPKVFLMDEPLSNLDAKLRVTMRTEISKLH
QRLEATIIYVTHDQTEAMTMGDRIVVMNEGEIQQVAKPHDIYHYPANLFVAGFIGSPGMN
FLKGIIEQQHGELFFTNSSIRLHIPEEKAKRLKEKGYAGEQMIAGVRPEHITQMTGNDQL
FDSVFQANVEVNENLGSELIVHVMAGDERLKVRLDGNTRIDAGDSIQLSVKMDHVVFFDA
ETEEAVY
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggcttcattaacatttgaacacgtcaaaaaatcatatcactcacaattaaccgtgaag
gactttgatttagatgtaaaggataaggagcttttggtgctggtggggccgtcaggatgc
ggaaaatcaacaacgctgcggatggtggctggattagaaagcatttctgaaggaaatctt
cttattgatggggagcgggtcaatgatcttccgccgaaagaacgtgatattgcgatggta
ttccagaactatgcgctttatccgcatatgacggtttttgataatatggcgtttggatta
aagctcagaaagatggcgaaacaggaaattgccgagcgggttcatgcggcagccagaatt
ttagaaattgaacatttgctgaagagaaaaccgaaggcgctctccggcgggcagcggcaa
agggtggcgcttggcaggtcgattgtgagggagccgaaggtctttttaatggacgagccg
ctttctaatctggatgcaaaactaagagtgacgatgcggacagaaatcagcaagctgcac
cagcgattagaggcaacgatcatttatgtcacgcatgaccagaccgaagcaatgacaatg
ggagatcggattgtcgtcatgaatgaaggggaaattcagcaagtggcgaaacctcatgac
atttatcattacccggccaatttgtttgtcgcaggcttcattggctctcccggaatgaac
tttttgaaaggcatcatagaacagcagcatggcgagctgtttttcacaaattcttcgatc
cggcttcatattcctgaagaaaaagcaaagcggctgaaggaaaagggatatgccggagaa
cagatgattgccggtgtacggccggagcacatcacacaaatgacaggaaatgaccagttg
tttgattcagtgtttcaagcgaacgtggaagtgaatgaaaatctgggctcggagctcata
gtgcatgtcatggctggggacgagcggctcaaggtccgcctggacggaaacacgcgaatc
gatgcaggcgattcaatccagctctcagtgaaaatggaccacgtcgtctttttcgatgcg
gaaacggaagaggctgtgtattag

DBGET integrated database retrieval system