KEGG   Bacillus subtilis subsp. subtilis 168: BSU32550Help
Entry
BSU32550          CDS       T00010                                 

Gene name
yurJ
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K10112  multiple sugar transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00196  Raffinose/stachyose/melibiose transport system
bsu_M00201  alpha-Glucoside transport system
bsu_M00207  Putative multiple sugar transport system
bsu_M00491  arabinogalactan oligomer/maltooligosaccharide transport system
bsu_M00602  Arabinosaccharide transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU32550 (yurJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32550 (yurJ)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194]
    BSU32550 (yurJ)
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491]
    BSU32550 (yurJ)
   Raffinose/stachyose/melibiose transporter [MD:M00196]
    BSU32550 (yurJ)
   alpha-Glucoside transporter [MD:M00201]
    BSU32550 (yurJ)
   Glucose/mannose transporter [MD:M00605]
    BSU32550 (yurJ)
   Cellobiose transporter [MD:M00206]
    BSU32550 (yurJ)
   N,N'-Diacetylchitobiose transporter [MD:M00606]
    BSU32550 (yurJ)
   Putative fructooligosaccharide transporter [MD:M00197]
    BSU32550 (yurJ)
   Putative sorbitol/mannitol transporter [MD:M00200]
    BSU32550 (yurJ)
   Arabinosaccharide transporter [MD:M00602]
    BSU32550 (yurJ)
   Putative multiple sugar transporter [MD:M00207]
    BSU32550 (yurJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran OB_MalK TOBE_2 AAA_21 Rad17 TOBE SMC_N CysA_C_terminal AAA_22 AAA_16 RsgA_GTPase AAA_15 AAA_23 AAA AAA_18 AAA_29 Zeta_toxin AAA_33 AAA_14 AAA_30
Motif
Other DBs
NCBI-GeneID: 937070
NCBI-ProteinID: NP_391135
Pasteur: BG13996
BSORF: BG13996
UniProt: O32151
Position
complement(3345013..3346116)
Genome map
AA seq 367 aa AA seqDB search
MASLTFEHVKKSYHSQLTVKDFDLDVKDKELLVLVGPSGCGKSTTLRMVAGLESISEGNL
LIDGERVNDLPPKERDIAMVFQNYALYPHMTVFDNMAFGLKLRKMAKQEIAERVHAAARI
LEIEHLLKRKPKALSGGQRQRVALGRSIVREPKVFLMDEPLSNLDAKLRVTMRTEISKLH
QRLEATIIYVTHDQTEAMTMGDRIVVMNEGEIQQVAKPHDIYHYPANLFVAGFIGSPGMN
FLKGIIEQQHGELFFTNSSIRLHIPEEKAKRLKEKGYAGEQMIAGVRPEHITQMTGNDQL
FDSVFQANVEVNENLGSELIVHVMAGDERLKVRLDGNTRIDAGDSIQLSVKMDHVVFFDA
ETEEAVY
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcttcattaacatttgaacacgtcaaaaaatcatatcactcacaattaaccgtgaag
gactttgatttagatgtaaaggataaggagcttttggtgctggtggggccgtcaggatgc
ggaaaatcaacaacgctgcggatggtggctggattagaaagcatttctgaaggaaatctt
cttattgatggggagcgggtcaatgatcttccgccgaaagaacgtgatattgcgatggta
ttccagaactatgcgctttatccgcatatgacggtttttgataatatggcgtttggatta
aagctcagaaagatggcgaaacaggaaattgccgagcgggttcatgcggcagccagaatt
ttagaaattgaacatttgctgaagagaaaaccgaaggcgctctccggcgggcagcggcaa
agggtggcgcttggcaggtcgattgtgagggagccgaaggtctttttaatggacgagccg
ctttctaatctggatgcaaaactaagagtgacgatgcggacagaaatcagcaagctgcac
cagcgattagaggcaacgatcatttatgtcacgcatgaccagaccgaagcaatgacaatg
ggagatcggattgtcgtcatgaatgaaggggaaattcagcaagtggcgaaacctcatgac
atttatcattacccggccaatttgtttgtcgcaggcttcattggctctcccggaatgaac
tttttgaaaggcatcatagaacagcagcatggcgagctgtttttcacaaattcttcgatc
cggcttcatattcctgaagaaaaagcaaagcggctgaaggaaaagggatatgccggagaa
cagatgattgccggtgtacggccggagcacatcacacaaatgacaggaaatgaccagttg
tttgattcagtgtttcaagcgaacgtggaagtgaatgaaaatctgggctcggagctcata
gtgcatgtcatggctggggacgagcggctcaaggtccgcctggacggaaacacgcgaatc
gatgcaggcgattcaatccagctctcagtgaaaatggaccacgtcgtctttttcgatgcg
gaaacggaagaggctgtgtattag

DBGET integrated database retrieval system