KEGG   Bacillus subtilis subsp. subtilis 168: BSU32560
Entry
BSU32560          CDS       T00010                                 

Gene name
frlR
Definition
(RefSeq) DNA-binding transcriptional regulator FrlR
  KO
K10711  GntR family transcriptional regulator, frlABCD operon transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU32560 (frlR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU32560 (frlR)
SSDB
Motif
Pfam: UTRA GntR HTH_41 HTH_DeoR HTH_11 HTH_36 Rep_fac_C HTH_24 HTH_27
Other DBs
NCBI-GeneID: 936688
NCBI-ProteinID: NP_391136
Pasteur: BG13997
BSORF: BG13997
UniProt: O32152 A0A6M4JMN9
Structure
PDB: 
2IKK

Position
3346238..3347026
AA seq 262 aa
MYYNVIIHYNINNRLKGGYPLLNNGSSTPLYIQLKQIITDDIKKGVYSPTAKLPTENELC
TKYNVSRITVRKAILDLVEEGYLIRQQGKGTFVKSPKLKRELIAVNGYSEFMESTGKKPK
HHVLSHDIIPASKPIAEKLQIQPESPVVELKRILYNDDQPLTFEVTHYPLDLFPGIDTFI
ADGVSMHDILKQQYKVVPTHNTKLLNVVYAQQEESKYLDCDIGDALFEIDKTAFTSNDQP
IYCSLFLMHTNRVTFTINSPYT
NT seq 789 nt   +upstreamnt  +downstreamnt
ttgtattataacgtcataatacattataatataaataataggttaaaaggaggctaccct
ttgttaaacaacggaagttctacacctttatacattcagctaaaacaaatcatcactgat
gacatcaaaaagggcgtgtattccccaaccgccaagctgcctaccgaaaacgagctttgc
accaagtataacgtcagccgcatcaccgtcaggaaagccattctcgatttagtcgaagaa
ggctatctgatcaggcagcagggaaagggaacgttcgttaaaagccctaaattaaaacga
gagctgatcgctgtaaacggctactcggaatttatggaatcaaccggcaaaaaaccgaag
catcatgtgctgtcccatgacatcattccagcgtcaaaacccatcgccgaaaagcttcaa
atccaacccgagagccctgtggttgaattaaaacggattttatataatgatgatcagcct
ctcacctttgaagtgacgcattatccgcttgatttgtttcccggcattgatacctttatt
gctgacggcgtctccatgcatgatattttgaaacagcaatacaaagttgtacccacgcac
aatacgaagctattaaacgttgtatatgcccaacaggaggaaagcaaatacctggattgt
gatatcggggatgcgctgtttgaaattgataaaacggcttttacatcaaacgaccagcca
atctattgctcattgtttttgatgcacacaaaccgtgtcacttttaccatcaacagcccc
tacacataa

DBGET integrated database retrieval system