KEGG   Bacillus subtilis subsp. subtilis 168: BSU32560Help
Entry
BSU32560          CDS       T00010                                 

Gene name
frlR
Definition
(RefSeq) DNA-binding transcriptional regulator FrlR
  KO
K10711  GntR family transcriptional regulator, frlABCD operon transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU32560 (frlR)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    BSU32560 (frlR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UTRA GntR HTH_DeoR HTH_36 HTH_11 HTH_41 Rep_fac_C HTH_27 HTH_24
Motif
Other DBs
NCBI-GeneID: 936688
NCBI-ProteinID: NP_391136
Pasteur: BG13997
BSORF: BG13997
UniProt: O32152
Structure
PDB: 

Position
3346238..3347026
Genome map
AA seq 262 aa AA seqDB search
MYYNVIIHYNINNRLKGGYPLLNNGSSTPLYIQLKQIITDDIKKGVYSPTAKLPTENELC
TKYNVSRITVRKAILDLVEEGYLIRQQGKGTFVKSPKLKRELIAVNGYSEFMESTGKKPK
HHVLSHDIIPASKPIAEKLQIQPESPVVELKRILYNDDQPLTFEVTHYPLDLFPGIDTFI
ADGVSMHDILKQQYKVVPTHNTKLLNVVYAQQEESKYLDCDIGDALFEIDKTAFTSNDQP
IYCSLFLMHTNRVTFTINSPYT
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgtattataacgtcataatacattataatataaataataggttaaaaggaggctaccct
ttgttaaacaacggaagttctacacctttatacattcagctaaaacaaatcatcactgat
gacatcaaaaagggcgtgtattccccaaccgccaagctgcctaccgaaaacgagctttgc
accaagtataacgtcagccgcatcaccgtcaggaaagccattctcgatttagtcgaagaa
ggctatctgatcaggcagcagggaaagggaacgttcgttaaaagccctaaattaaaacga
gagctgatcgctgtaaacggctactcggaatttatggaatcaaccggcaaaaaaccgaag
catcatgtgctgtcccatgacatcattccagcgtcaaaacccatcgccgaaaagcttcaa
atccaacccgagagccctgtggttgaattaaaacggattttatataatgatgatcagcct
ctcacctttgaagtgacgcattatccgcttgatttgtttcccggcattgatacctttatt
gctgacggcgtctccatgcatgatattttgaaacagcaatacaaagttgtacccacgcac
aatacgaagctattaaacgttgtatatgcccaacaggaggaaagcaaatacctggattgt
gatatcggggatgcgctgtttgaaattgataaaacggcttttacatcaaacgaccagcca
atctattgctcattgtttttgatgcacacaaaccgtgtcacttttaccatcaacagcccc
tacacataa

DBGET integrated database retrieval system