KEGG   Bacillus subtilis subsp. subtilis 168: BSU32570
Entry
BSU32570          CDS       T00010                                 

Gene name
frlD
Definition
(RefSeq) fructosamine kinase FrlD
  KO
K10710  fructoselysine 6-kinase [EC:2.7.1.218]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU32570 (frlD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.218  fructoselysine 6-kinase
     BSU32570 (frlD)
SSDB
Motif
Pfam: PfkB XdhC_C
Other DBs
NCBI-GeneID: 936704
NCBI-ProteinID: NP_391137
Pasteur: BG13998
BSORF: BG13998
UniProt: O32153 A0A6M4JNC7
Position
complement(3347051..3347905)
AA seq 284 aa
MKLIAVGDNVVDYYQDQETFYPGGNALNVAVLAKRLGHESSYIGIVGNDEAAAHLLNVLK
LEQVNADYIRQAHGENGMAIVTLDEQGDRIFVRSNKGGIQSRLRLAFQEKDVSFISGHDL
LHTSVYSRLENDLPQLCGLVPVSFDFSTNREDDYLRRVCPYVTYAFFSGSDLSESECGEL
AKTAHGYGAKMVCMTRGGQGAILSAGDRVYHQPIVEADIIDTLGAGDSFIAGFLTAFCVK
QDITYALRQAAETAAKTCGVYGAFGYGYPYRLEDGGSSEKTRIL
NT seq 855 nt   +upstreamnt  +downstreamnt
atgaaattgattgcggttggagataatgttgtagattactaccaggatcaagaaacattt
tacccgggaggaaatgccttaaacgttgctgtgcttgccaagcggctcgggcatgagtct
tcctatatcggaatcgtcggcaatgacgaagccgcggcgcatctgttgaacgttctcaag
ctggagcaggtcaatgcagattatatccgccaggcgcacggagaaaacgggatggcgatt
gtcacccttgatgaacagggggaccgcatttttgtcagatcaaataaaggcggcattcag
tcccggcttcgcctcgcgtttcaggagaaagatgtatcttttatcagcgggcatgatctg
ctgcatacgagcgtgtacagcaggcttgagaacgatcttccgcagctgtgcgggctggtc
ccggtctcatttgatttttcaaccaatcgggaggatgattatttgaggagggtctgtcct
tatgtgacgtatgcgtttttttcaggaagcgatttgagtgagtcggaatgcggtgagctt
gccaaaacagctcatgggtacggagccaaaatggtttgtatgacccgagggggccaagga
gcaatcctgtctgcgggtgatcgagtctatcatcagccgattgtggaagctgatataata
gatacacttggagcgggagattcttttatagcaggctttttgactgccttttgcgtgaag
caggatataacgtatgctttgcgccaggctgctgaaacggctgcgaaaacttgcggtgtg
tacggagctttcggctatggctatccttatcgcttggaggacgggggaagcagtgaaaaa
acgagaatactataa

DBGET integrated database retrieval system