KEGG   Bacillus subtilis subsp. subtilis 168: BSU32580Help
Entry
BSU32580          CDS       T00010                                 

Gene name
frlM
Definition
(RefSeq) ABC transporter permease
  KO
K10119  raffinose/stachyose/melibiose transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00196  Raffinose/stachyose/melibiose transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU32580 (frlM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32580 (frlM)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter [MD:M00196]
    BSU32580 (frlM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 MAP17
Motif
Other DBs
NCBI-GeneID: 936696
NCBI-ProteinID: NP_391138
Pasteur: BG13999
BSORF: BG13999
UniProt: O32154
Position
complement(3347919..3348821)
Genome map
AA seq 300 aa AA seqDB search
MLPQKKTDSFRLEPVPDQHIEVKDKPRRKWYIGETSVWVFLFLYLIAIAYPLLWMVMSAF
KNSDDIFEHSWSLPSSWHPENFVSAWNQGISSYFMNSVIVTALTCVITVFISAWAAYGLS
RFEFKGKGFFLVLCLGGLMLTPQVSLVPLYSIIQSLGLYNTYWALILPYAAYRIPFTIIL
IRSYFLSISKELEEAAYLDGCTSFGVFFRIFLPMSVPILVTSGILTAYHTWNEFMFAIIF
IDDENLRTIPAGLMQFRDALQTDWGVLLAGLTISAAPIIILFLLMQKYFVRGIASGSVKG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctcagaagaagacagattcgttcagattggagccggtgcctgaccagcacatt
gaggtgaaagataagcctagacgaaaatggtatatcggagaaacgtctgtgtgggttttt
ctgtttctttatctgattgcgattgcctatccgcttctctggatggtgatgagcgccttt
aaaaactctgacgatatttttgagcacagctggtcgctgccgtcttcgtggcatccggaa
aattttgtttccgcctggaatcaggggatttcttcttattttatgaacagtgtcatcgtt
acggcgctgacgtgtgtgatcactgtctttatcagtgcatgggcagcgtatggcctttcc
cggtttgagtttaaaggaaaaggattctttttggtgctatgtcttggcggattgatgctg
acgccgcaggtcagtcttgtgccgctttattctattattcagtcgctgggcctgtacaat
acgtattgggcgttaatcttgccgtatgcggcttatcggatcccattcaccatcattttg
atccgctcttattttctttctatttcaaaagaattggaggaggcggcctatttggatggg
tgtacaagttttggagtatttttcagaattttcttaccaatgagcgtgccgattttggtg
acatccggcattttgacggcttaccatacatggaatgagtttatgtttgcgattattttc
atagatgatgagaatttacggaccattccagccgggctgatgcagttcagagacgcgctg
cagacagactggggcgtcctgctggcggggttaacgatttcagccgcgccgattattatt
ctatttttattgatgcagaaatattttgtccgcgggattgcaagcggcagtgtaaaagga
taa

DBGET integrated database retrieval system