KEGG   Bacillus subtilis subsp. subtilis 168: BSU32590
Entry
BSU32590          CDS       T00010                                 

Gene name
frlN
Definition
(RefSeq) ABC transporter permease
  KO
K10118  raffinose/stachyose/melibiose transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU32590 (frlN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32590 (frlN)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter
    BSU32590 (frlN)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 936689
NCBI-ProteinID: NP_391139
Pasteur: BG14000
BSORF: BG14000
UniProt: O32155 A0A6M4JP09
Position
complement(3348825..3349703)
AA seq 292 aa
MVNQNKIIPYLFLVPALVFLLFVYIPIFENVFLSLFQWSSFSPEKTFIGLKNYVELFHDP
VFYQALTNNVLYAVISIVCQVFGGLILAAVLEDKLVRKWSPFFRTVFFLPVVISMTVIAL
LFDFIYNPETGLLNQLLQAIGLDQLTRAWLGDDSTAMLSVIFVSQWQSVGYIAMLYIVSI
QKIPDELYEAARLDGAGKIQQFFHITVPQTKEMSFVAVVMTLTGAFTVFNEPYILTGGGP
GKASEVLSTFLYKSAFTKDMMGYASAIATVVLIITLALSLMQMKFFKTGKEE
NT seq 879 nt   +upstreamnt  +downstreamnt
ttggtcaatcagaataaaataatcccctatttgtttttggtgcccgctctcgttttttta
cttttcgtttatatcccgatttttgagaatgtattcctcagcctgtttcagtggagctca
ttttctccggaaaaaacgtttatcggcttaaaaaactatgttgaattatttcatgatcct
gtcttctatcaggcacttaccaataatgtgctttatgcagtgatctcaattgtatgccag
gtatttggcggtttgattttggcggcggtgcttgaggataagctggtcagaaaatggtcg
ccgttttttcgtaccgttttctttttgccggttgtcatctcaatgacggtgatcgcgctt
ttgtttgattttatttacaatccggagacagggcttttgaatcagctgcttcaggccatc
ggtcttgatcagctgacgagggcctggctcggggatgacagcacagctatgctttctgtc
atttttgtgtcccagtggcaatctgtcggttatattgcgatgctgtacatcgtgtcgatt
caaaaaataccggatgaactgtatgaagcggcccggcttgacggcgcgggtaaaattcag
cagttttttcatattactgttccccagacgaaagagatgtcttttgttgcggtggtcatg
acgctgaccggagcctttacggtctttaatgagccgtacattttgacaggcggcgggccg
ggaaaagcgtcagaagtcttgagcacgtttttatataaaagcgcctttacaaaggatatg
atgggctacgcctcagcgattgccactgtcgtgttaatcattacgcttgcattatcgctc
atgcaaatgaagttctttaaaaccggaaaggaggagtaa

DBGET integrated database retrieval system