KEGG   Bacillus subtilis subsp. subtilis 168: BSU32590Help
Entry
BSU32590          CDS       T00010                                 

Gene name
frlN
Definition
(RefSeq) ABC transporter permease
  KO
K10118  raffinose/stachyose/melibiose transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00196  Raffinose/stachyose/melibiose transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU32590 (frlN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32590 (frlN)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter [MD:M00196]
    BSU32590 (frlN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 936689
NCBI-ProteinID: NP_391139
Pasteur: BG14000
BSORF: BG14000
UniProt: O32155
Position
complement(3348825..3349703)
Genome map
AA seq 292 aa AA seqDB search
MVNQNKIIPYLFLVPALVFLLFVYIPIFENVFLSLFQWSSFSPEKTFIGLKNYVELFHDP
VFYQALTNNVLYAVISIVCQVFGGLILAAVLEDKLVRKWSPFFRTVFFLPVVISMTVIAL
LFDFIYNPETGLLNQLLQAIGLDQLTRAWLGDDSTAMLSVIFVSQWQSVGYIAMLYIVSI
QKIPDELYEAARLDGAGKIQQFFHITVPQTKEMSFVAVVMTLTGAFTVFNEPYILTGGGP
GKASEVLSTFLYKSAFTKDMMGYASAIATVVLIITLALSLMQMKFFKTGKEE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttggtcaatcagaataaaataatcccctatttgtttttggtgcccgctctcgttttttta
cttttcgtttatatcccgatttttgagaatgtattcctcagcctgtttcagtggagctca
ttttctccggaaaaaacgtttatcggcttaaaaaactatgttgaattatttcatgatcct
gtcttctatcaggcacttaccaataatgtgctttatgcagtgatctcaattgtatgccag
gtatttggcggtttgattttggcggcggtgcttgaggataagctggtcagaaaatggtcg
ccgttttttcgtaccgttttctttttgccggttgtcatctcaatgacggtgatcgcgctt
ttgtttgattttatttacaatccggagacagggcttttgaatcagctgcttcaggccatc
ggtcttgatcagctgacgagggcctggctcggggatgacagcacagctatgctttctgtc
atttttgtgtcccagtggcaatctgtcggttatattgcgatgctgtacatcgtgtcgatt
caaaaaataccggatgaactgtatgaagcggcccggcttgacggcgcgggtaaaattcag
cagttttttcatattactgttccccagacgaaagagatgtcttttgttgcggtggtcatg
acgctgaccggagcctttacggtctttaatgagccgtacattttgacaggcggcgggccg
ggaaaagcgtcagaagtcttgagcacgtttttatataaaagcgcctttacaaaggatatg
atgggctacgcctcagcgattgccactgtcgtgttaatcattacgcttgcattatcgctc
atgcaaatgaagttctttaaaaccggaaaggaggagtaa

DBGET integrated database retrieval system