KEGG   Bacillus subtilis subsp. subtilis 168: BSU32600
Entry
BSU32600          CDS       T00010                                 

Gene name
frlO
Definition
(RefSeq) ABC transporter substrate-binding protein YurO
  KO
K10117  raffinose/stachyose/melibiose transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU32600 (frlO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32600 (frlO)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter
    BSU32600 (frlO)
SSDB
Motif
Pfam: SBP_bac_1 SBP_bac_8 SBP_bac_6 Meiosis_expr
Other DBs
NCBI-GeneID: 937094
NCBI-ProteinID: NP_391140
Pasteur: BG14001
BSORF: BG14001
UniProt: O32156 A0A6M3ZKP3
Position
complement(3349761..3351029)
AA seq 422 aa
MKKMLLFLIIAAVSMLTIAGCSSQSSSADGKVTLKFFHRWPKEPEKSYFEEVVKEFEKDH
PDIDIQIEAVLNDSYKDKIKVMLGTTSPPDIYFSWSDEFAFKFIRGNKALDLSSYYKNDT
DWSSQLVQSQITPFTYENKQYGVPWQMDAKSFFYNKDIFQKLNLDPPKTWDELIDVSKKL
KEHGYTPISFGTKATWTISHYIGTLNQRMVDEKTREKDYNAKTGEFTDEGYVKALEKLQE
LMPYFNKHVNSVDHEYVRQQFKSGKSAMIYAETAEIKLVEPVNLGMFPFPEISGQKGSSE
ALTGAPEGFMISSRTKHPKEAMEFLQFLTSKRMGEKLVKDVGKYSAVQGTATEENATAIQ
REAVQHIVDAKSMVPWFDMDVDVEVADAYLTGVQQMLGGDMTPQQVMKAVQKAAKQVRAS
AE
NT seq 1269 nt   +upstreamnt  +downstreamnt
ttgaagaaaatgttgttgttcttgatcattgcagctgtcagtatgctcaccatcgcaggc
tgttcgagccaaagcagttcagcggacggaaaggtgacattgaaatttttccacagatgg
ccaaaggagccggaaaaaagttattttgaagaggttgttaaggaatttgaaaaagatcac
ccagatatcgacattcaaattgaagccgttttaaatgactcctataaagataaaattaag
gtcatgctgggaaccaccagccctcctgacatttacttctcttggagcgatgagtttgct
tttaaatttatcagaggcaataaagcacttgatctctcgtcctactacaaaaatgacacc
gattggtcatcacagctcgttcaatcgcaaattacaccatttacttatgaaaacaagcaa
tatggcgtaccgtggcaaatggacgctaaatcattcttctataataaagacattttccaa
aagctgaatcttgatcccccgaagacgtgggatgaattaatcgatgtgtcaaaaaagctg
aaagaacatggctacacaccgatcagctttggaacaaaggcgacttggacaatctcgcac
tatatcggcacgcttaatcagcggatggtcgatgaaaaaacacgggaaaaggactataac
gccaaaacgggtgaatttactgatgaaggctacgtaaaagcacttgaaaagcttcaagag
ctgatgccttactttaataaacatgtaaactccgtcgaccacgaatatgtgagacagcaa
tttaagagcggaaagtcggcgatgatatatgcggaaacagcggaaatcaagctggttgaa
ccggttaatctcgggatgttcccatttcctgaaatcagcgggcagaaaggatcttcagaa
gcgttaacgggagcgccggaaggattcatgatctcctcaagaacaaaacatccgaaggaa
gcgatggaatttttgcagttcttgacgtcgaaaagaatgggcgaaaagctcgtgaaagat
gtcgggaaatacagtgcagtgcaaggtacggctactgaagaaaatgcaacagccattcag
cgtgaagccgttcagcatattgttgatgccaaatcaatggttccatggtttgatatggat
gtcgatgttgaagtcgcagatgcgtacctaacgggcgtccagcaaatgcttggcggcgac
atgacaccgcagcaggtgatgaaagccgttcaaaaggcagcaaagcaggtgagggcgtca
gctgaataa

DBGET integrated database retrieval system