KEGG   Bacillus subtilis subsp. subtilis 168: BSU32610Help
Entry
BSU32610          CDS       T00010                                 

Gene name
frlB
Definition
(RefSeq) fructosamine deglycase FrlB
  KO
K10708  fructoselysine 6-phosphate deglycase [EC:3.5.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU32610 (frlB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.-  Acting on carbon-nitrogen bonds, other than peptide bonds
    3.5.-.-  
     BSU32610 (frlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS SIS_2 Nrap_D5
Motif
Other DBs
NCBI-GeneID: 936701
NCBI-ProteinID: NP_391141
Pasteur: BG14002
BSORF: BG14002
UniProt: O32157
Structure
PDB: 

Position
complement(3351110..3352096)
Genome map
AA seq 328 aa AA seqDB search
MSQATAKVNREVQAFLQDLKGKTIDHVFFVACGGSSAIMYPSKYVFDRESKSINSDLYSA
NEFIQRNPVQLGEKSLVILCSHSGNTPETVKAAAFARGKGALTIAMTFKPESPLAQEAQY
VAQYDWGDEALAINTNYGVLYQIVFGTLQVLENNTKFEQAIEGLDQLQAVYEKALKQEAD
NAKQFAKAHEKESIIYTMASGANYGVAYSYSICILMEMQWIHSHAIHAGEYFHGPFEIID
ESVPFIILLGLDETRPLEERALTFSKKYGKKLTVLDAASYDFTAIDDSVKGYLAPLVLNR
VLRSYADELAEERNHPLSHRRYMWKVEY
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcaggccacagcaaaagtaaatcgtgaggttcaagctttcttgcaggatttgaaa
gggaaaaccattgatcatgtattctttgtcgcatgcggagggtcttctgccattatgtat
ccgagtaagtatgtgtttgacagagagtcaaaatcaataaactccgatctctacagcgcc
aacgaatttattcagcgcaaccctgttcagcttggtgaaaagtctcttgttattttgtgc
tcgcattcgggaaataccccggagacagtcaaagctgctgcgtttgcaaggggcaagggc
gcacttacgattgcgatgacgtttaaaccggagtctcctttagcgcaggaagcgcaatat
gttgcccagtacgattggggtgatgaggcgcttgcgatcaatacaaactatggcgttttg
tatcaaatcgtttttggaaccctgcaagtattagaaaacaatacgaaatttgagcaagca
attgaaggcttagatcaattgcaggctgtatatgaaaaagcccttaagcaggaagctgac
aacgccaagcaatttgcaaaagcccatgaaaaagaaagcattatttataccatggcaagc
ggtgcaaactacggtgtcgcttactcctacagcatctgcattctcatggaaatgcaatgg
attcattcccacgccattcatgccggagaatattttcacggaccgtttgaaattattgat
gaatccgtgccgtttatcatcctgctcggtttagatgaaacaagacctcttgaagagcgg
gcgcttaccttctcgaaaaagtatggcaaaaagctcactgtgcttgatgctgcatcttac
gacttcactgcaattgacgattcagttaaaggctatcttgctccgctcgttctcaatcgt
gtgctgagaagctatgcagacgagctggcagaggagagaaatcatcctttatctcataga
agatacatgtggaaagttgagtattga

DBGET integrated database retrieval system