KEGG   Bacillus subtilis subsp. subtilis 168: BSU32620Help
Entry
BSU32620          CDS       T00010                                 

Gene name
yurQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIY-YIG
Motif
Other DBs
NCBI-GeneID: 936694
NCBI-ProteinID: NP_391142
Pasteur: BG14003
BSORF: BG14003
UniProt: O32158
Position
complement(3352312..3352686)
Genome map
AA seq 124 aa AA seqDB search
MIKIDIPAPNVTITERQQSANDNEPKIKPIHGFIDFHQIPRDKGGIFMFYNIHDELLFVG
KARKLRQRIKKHFEDTVSPIKHHRDEVYKIEVCVVDDPMEREIYETYIINTQHSKYNIDK
VFFK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
ttgataaaaattgatatacccgcaccgaatgtcaccatcactgaacgacagcagtcagct
aatgataacgagccgaagataaaaccgattcacggattcatcgactttcaccagatccca
agggacaaaggcggcatttttatgttttacaacattcatgacgagctgctgtttgtcggt
aaagccagaaagttaagacagagaattaagaagcatttcgaagacactgtttcaccgatc
aaacatcacagagatgaagtttataaaattgaggtatgtgtagttgatgatccaatggaa
agagagatttacgaaacatatatcatcaatacacagcactcgaagtacaatatagacaag
gtattttttaaataa

DBGET integrated database retrieval system