KEGG   Bacillus subtilis subsp. subtilis 168: BSU32630
Entry
BSU32630          CDS       T00010                                 

Gene name
yurR
Definition
(RefSeq) oxidoreductase
  KO
K00285  D-amino-acid dehydrogenase [EC:1.4.5.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00360  Phenylalanine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BSU32630 (yurR)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.5  With a quinone or other compound as acceptor
    1.4.5.1  D-amino acid dehydrogenase (quinone)
     BSU32630 (yurR)
SSDB
Motif
Pfam: DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 Pyr_redox_3 GIDA ApbA FAD_binding_3 Pyr_redox NAD_binding_7 3HCDH_N NAD_binding_9 HI0933_like TrkA_N Trp_halogenase FAD_oxidored UDPG_MGDP_dh_N Shikimate_DH Sacchrp_dh_NADP KR NAD_binding_2 Thi4 XdhC_C AlaDh_PNT_C adh_short
Other DBs
NCBI-GeneID: 937069
NCBI-ProteinID: NP_391143
Pasteur: BG14004
BSORF: BG14004
UniProt: O32159 A0A6M3ZGC8
Position
complement(3352789..3353907)
AA seq 372 aa
MKSYIIVGAGILGASTAYHLAKTGARVTVIDRKEPGQATDAAAGIVCPWLSQRRNQDWYQ
LAKGGARYYKDLIHQLEKDGESDTGYKRVGAISIHTDASKLDKMEERAYKRREDAPEIGD
ITRLSASETKKLFPILADGYESVHISGAARVNGRALCRSLLSAAEKRGATVIKGNASLLF
ENGTVTGVQTDTKQFAADAVIVTAGAWANEILKPLGIHFQVSFQKAQIMHFEMTDADTGS
WPVVMPPSDQYILSFDNGRIVAGATHENDAGLDDLRVTAGGQHEVLSKALAVAPGLADAA
AVETRVGFRPFTPGFLPVVGAVPNVQGLYAANGLGASGLTMGPFLGAELAKLVLGKQTEL
DLSPYDPAGALA
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgaaatcgtacatcatcgtcggcgcagggattctgggcgcgtcgacggcttatcatctc
gcaaaaacaggcgctcgcgttactgtcattgatcggaaagagccgggacaagcgactgat
gcggcggcggggatcgtctgtccttggctctcgcagcgccgtaatcaggattggtaccag
cttgctaaggggggagcgcggtactataaggatttaatccatcaattggaaaaagacggt
gaatcggatacaggatacaaacgtgtcggtgccatcagcattcatactgacgcgtctaaa
ctcgataaaatggaggaaagggcgtataagagacgggaggatgcgccggaaatcggcgac
attacccgcttgtctgcaagtgaaacgaaaaagctgtttccgattttagctgacggctat
gaatcggttcatatcagcggtgccgcccgtgtgaacggaagagcgctgtgccggtcgctt
ttaagcgctgcagagaaacgcggcgcaacggtcatcaaaggaaatgcgtccttgcttttt
gaaaacggaacagtcaccggcgtgcaaacagatacaaagcagtttgcggctgacgcggtc
attgtgacggcgggagcatgggccaatgagatattgaagcctcttggcattcattttcaa
gtgtcatttcaaaaagcgcagattatgcattttgaaatgacagatgcagatacaggatcg
tggccggttgtaatgccgccgagtgatcagtacattctgtcgtttgataacggcagaatt
gtagccggcgccacacacgaaaacgatgccggtcttgatgatcttcgtgtgacagccgga
ggccagcacgaagtattgagcaaagcgttagccgttgcaccgggtcttgctgatgcggct
gctgttgaaacaagagtgggcttcaggccgtttacaccgggatttctgccggtcgtaggg
gccgtgccgaatgttcaaggcctgtacgctgcaaacggtttgggtgcttctggactgacg
atggggccgtttttgggtgcagagctcgcaaagctagttctcggaaagcagacagaatta
gaccttagtccttatgatccagccggagcacttgcataa

DBGET integrated database retrieval system