KEGG   Bacillus subtilis subsp. subtilis 168: BSU32630Help
Entry
BSU32630          CDS       T00010                                 

Gene name
yurR
Definition
(RefSeq) oxidoreductase
  KO
K00285  D-amino-acid dehydrogenase [EC:1.4.5.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00360  Phenylalanine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BSU32630 (yurR)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.5  With a quinone or other compound as acceptor
    1.4.5.1  D-amino acid dehydrogenase (quinone)
     BSU32630 (yurR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 Pyr_redox_3 GIDA ApbA FAD_binding_3 3HCDH_N Pyr_redox NAD_binding_7 NAD_binding_9 TrkA_N HI0933_like Trp_halogenase NAD_binding_2 UDPG_MGDP_dh_N Shikimate_DH Sacchrp_dh_NADP Thi4 KR adh_short
Motif
Other DBs
NCBI-GeneID: 937069
NCBI-ProteinID: NP_391143
Pasteur: BG14004
BSORF: BG14004
UniProt: O32159
Position
complement(3352789..3353907)
Genome map
AA seq 372 aa AA seqDB search
MKSYIIVGAGILGASTAYHLAKTGARVTVIDRKEPGQATDAAAGIVCPWLSQRRNQDWYQ
LAKGGARYYKDLIHQLEKDGESDTGYKRVGAISIHTDASKLDKMEERAYKRREDAPEIGD
ITRLSASETKKLFPILADGYESVHISGAARVNGRALCRSLLSAAEKRGATVIKGNASLLF
ENGTVTGVQTDTKQFAADAVIVTAGAWANEILKPLGIHFQVSFQKAQIMHFEMTDADTGS
WPVVMPPSDQYILSFDNGRIVAGATHENDAGLDDLRVTAGGQHEVLSKALAVAPGLADAA
AVETRVGFRPFTPGFLPVVGAVPNVQGLYAANGLGASGLTMGPFLGAELAKLVLGKQTEL
DLSPYDPAGALA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgtacatcatcgtcggcgcagggattctgggcgcgtcgacggcttatcatctc
gcaaaaacaggcgctcgcgttactgtcattgatcggaaagagccgggacaagcgactgat
gcggcggcggggatcgtctgtccttggctctcgcagcgccgtaatcaggattggtaccag
cttgctaaggggggagcgcggtactataaggatttaatccatcaattggaaaaagacggt
gaatcggatacaggatacaaacgtgtcggtgccatcagcattcatactgacgcgtctaaa
ctcgataaaatggaggaaagggcgtataagagacgggaggatgcgccggaaatcggcgac
attacccgcttgtctgcaagtgaaacgaaaaagctgtttccgattttagctgacggctat
gaatcggttcatatcagcggtgccgcccgtgtgaacggaagagcgctgtgccggtcgctt
ttaagcgctgcagagaaacgcggcgcaacggtcatcaaaggaaatgcgtccttgcttttt
gaaaacggaacagtcaccggcgtgcaaacagatacaaagcagtttgcggctgacgcggtc
attgtgacggcgggagcatgggccaatgagatattgaagcctcttggcattcattttcaa
gtgtcatttcaaaaagcgcagattatgcattttgaaatgacagatgcagatacaggatcg
tggccggttgtaatgccgccgagtgatcagtacattctgtcgtttgataacggcagaatt
gtagccggcgccacacacgaaaacgatgccggtcttgatgatcttcgtgtgacagccgga
ggccagcacgaagtattgagcaaagcgttagccgttgcaccgggtcttgctgatgcggct
gctgttgaaacaagagtgggcttcaggccgtttacaccgggatttctgccggtcgtaggg
gccgtgccgaatgttcaaggcctgtacgctgcaaacggtttgggtgcttctggactgacg
atggggccgtttttgggtgcagagctcgcaaagctagttctcggaaagcagacagaatta
gaccttagtccttatgatccagccggagcacttgcataa

DBGET integrated database retrieval system