KEGG   Bacillus subtilis subsp. subtilis 168: BSU32650Help
Entry
BSU32650          CDS       T00010                                 

Gene name
yurS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 936705
NCBI-ProteinID: NP_391144
Pasteur: BG14005
BSORF: BG14005
UniProt: O32160
Position
3354212..3354487
Genome map
AA seq 91 aa AA seqDB search
MNENIIPLNRHTQEIPTTESVIKNSGNSEVHIDIHIDTMPIAFAILCSALAAKQMTKEEF
DMAYTQLREMNRENNSRSSVKQIINQETEEE
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaacatcattcctcttaacagacatactcaagagatacccactactgaatct
gttatcaaaaacagcggcaactcagaggtccatatcgacattcacattgatacaatgcca
attgcttttgctatattatgctctgcattagccgcaaagcagatgacaaaagaggaattc
gatatggcttatactcaattgcgagagatgaacagagaaaataacagcagatcatctgta
aagcaaattatcaatcaagagacagaagaagagtaa

DBGET integrated database retrieval system