KEGG   Bacillus subtilis subsp. subtilis 168: BSU32650
Entry
BSU32650          CDS       T00010                                 

Gene name
yurS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 936705
NCBI-ProteinID: NP_391144
Pasteur: BG14005
BSORF: BG14005
UniProt: O32160 A0A6M3ZFU6
Position
3354212..3354487
AA seq 91 aa
MNENIIPLNRHTQEIPTTESVIKNSGNSEVHIDIHIDTMPIAFAILCSALAAKQMTKEEF
DMAYTQLREMNRENNSRSSVKQIINQETEEE
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaacgaaaacatcattcctcttaacagacatactcaagagatacccactactgaatct
gttatcaaaaacagcggcaactcagaggtccatatcgacattcacattgatacaatgcca
attgcttttgctatattatgctctgcattagccgcaaagcagatgacaaaagaggaattc
gatatggcttatactcaattgcgagagatgaacagagaaaataacagcagatcatctgta
aagcaaattatcaatcaagagacagaagaagagtaa

DBGET integrated database retrieval system