KEGG   Bacillus subtilis subsp. subtilis 168: BSU32660Help
Entry
BSU32660          CDS       T00010                                 

Gene name
yurT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_5 Glyoxalase_4 Glyoxalase_6 Glyoxalase_3
Motif
Other DBs
NCBI-GeneID: 937193
NCBI-ProteinID: NP_391145
Pasteur: BG14006
BSORF: BG14006
UniProt: O32161
Position
complement(3354551..3354934)
Genome map
AA seq 127 aa AA seqDB search
MKIVVTSIFVQDQDMALEFYTEKLGFIKKEDVPMGKFRWITLVSPDDQDGTELLLEPNEH
PAAKEYQKKIFSEGLPATMFGVADIQKEYNRLKEKGVTFTTEPTKMGEVTIAVFDDTCGN
LIQIVQK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgttgttaccagtatatttgtacaagatcaagacatggcactggagttttat
acagaaaaacttgggtttataaaaaaggaagacgttcccatggggaaattcaggtggata
acgcttgtttctccagatgatcaagacggaaccgagcttttactcgaaccgaatgaacat
cctgccgccaaggagtatcaaaagaagatattctccgaaggcctcccggccacaatgttt
ggcgttgcagatattcaaaaagagtacaaccgattaaaggaaaaaggcgtgacgtttacg
acggaaccgacaaaaatgggcgaagtcacaatagctgtcttcgacgatacatgcggtaac
cttattcaaattgtacagaagtaa

DBGET integrated database retrieval system