KEGG   Bacillus subtilis subsp. subtilis 168: BSU32669Help
Entry
BSU32669          CDS       T00010                                 

Gene name
yuzN
Definition
(RefSeq) HTH-type transcriptional regulator YuzN
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_20 HTH_5 MarR_2 HTH_Crp_2 HTH_24 HTH_11 MarR TBPIP HTH_12 Mrr_N HTH_CodY Rrf2 DUF4423 CENP-B_N
Motif
Other DBs
NCBI-GeneID: 8303129
NCBI-ProteinID: YP_003097781
UniProt: C0H3Q8
Position
complement(3355045..3355323)
Genome map
AA seq 92 aa AA seqDB search
MNGNKDAIFKALGDSTRRLILDELSERNELTLYELTIRLITKYDLSITRQAIAKHLSVLE
DAGLVTSKRKGKYRVLIFNNEPLKNLLKGWIE
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggaacaaagacgctatattcaaagcactcggcgattcgactcggcggcttata
ttagacgaattatctgaacgcaacgagctgacgttgtatgaacttacgatacgtcttatt
acaaagtacgacctttctattacgcgacaggcgatagctaaacacctttctgtactggag
gatgcaggactcgtaacatcaaaacgaaagggaaaatatcgagtacttatattcaacaac
gaaccgcttaaaaatttgctgaaaggatggatagaataa

DBGET integrated database retrieval system