KEGG   Bacillus subtilis subsp. subtilis 168: BSU32670Help
Entry
BSU32670          CDS       T00010                                 

Gene name
sufB
Definition
(RefSeq) FeS cluster assembly protein SufB
  KO
K09014  Fe-S cluster assembly protein SufB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU32670 (sufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0051
Motif
Other DBs
NCBI-GeneID: 936706
NCBI-ProteinID: NP_391146
Pasteur: BG14007
BSORF: BG14007
UniProt: O32162
Position
complement(3355593..3356990)
Genome map
AA seq 465 aa AA seqDB search
MAKKMPDIGEYKYGFHDKDVSIFRSERGLTKEIVEEISRMKEEPQWMLDFRLKSLEHFYN
MPMPQWGGDLNSLNFDEITYYVKPSERSERSWDEVPEEIKQTFDKLGIPEAEQKYLAGVS
AQYESEVVYHNMKEDLEAQGIVFKDTDSALKENEDIFREHWAKVIPPTDNKFAALNSAVW
SGGSFIYVPKGVKVETPLQAYFRINSENMGQFERTLIIVDEEASVHYVEGCTAPVYTTNS
LHSAVVEIIVKKGGYCRYTTIQNWANNVYNLVTKRTVCEENATMEWIDGNIGSKLTMKYP
ACILKGEGARGMTLSIALAGKGQHQDAGAKMIHLAPNTSSTIVSKSISKQGGKVTYRGIV
HFGRKAEGARSNIECDTLIMDNKSTSDTIPYNEILNDNISLEHEAKVSKVSEEQLFYLMS
RGISEEEATEMIVMGFIEPFTKELPMEYAVEMNRLIKFEMEGSIG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaatgcctgatattggtgaatacaagtatggttttcacgacaaggacgtt
tccattttccgttcagagcgcggattgacaaaagaaatcgtagaagaaatttctcgcatg
aaagaagagcctcaatggatgcttgacttccgcttgaaatcacttgagcatttctacaat
atgccgatgcctcaatggggcggagatttaaactcactgaactttgacgaaattacgtac
tacgtaaaaccgtctgagcgttcagagcgttcttgggatgaagttcctgaagaaattaaa
caaacattcgacaagctcggtattcctgaagctgaacaaaaataccttgcgggtgtttct
gctcagtacgaatctgaggttgtataccacaacatgaaagaagatcttgaagcacaaggc
atcgtctttaaagacactgacagcgcgctgaaagagaatgaagatattttccgtgagcac
tgggcaaaagtaatcccgccgactgataacaagtttgcggcgcttaactcagctgtttgg
tccggcggttctttcatctacgtgcctaaaggcgtgaaggttgaaacaccgctacaagct
tacttccgtatcaactctgagaacatgggtcagttcgaacgtacactgatcattgttgac
gaagaagcaagcgttcattatgttgaaggctgtactgcgcctgtttacacaacaaactca
cttcacagtgcggtcgttgagatcatcgtgaaaaaaggcggctactgccgttatacaacg
atccaaaactgggcgaacaacgtttacaaccttgtaacaaagcgtacagtctgtgaagaa
aacgcaacaatggaatggatcgacggcaacatcggttctaagctgacaatgaaatatccg
gcttgtatcctaaaaggcgaaggcgcgcgcggtatgacgctttctatcgctcttgcgggt
aaaggccagcatcaggatgcaggtgcgaaaatgattcaccttgcaccaaacacatcatct
acaatcgtatcaaaatcgatttcaaaacagggcggaaaagtaacgtaccgcggaatcgtc
cacttcggacgcaaagcggaaggcgcccgctctaacatcgagtgtgatacgctcattatg
gataacaaatcaacttctgacacaattccttacaatgaaatcttaaatgataacatttca
ttggagcacgaagcgaaagtgtctaaagtatctgaagagcagctcttctacttgatgagc
cgcggtatttctgaagaagaagcaactgaaatgatcgtaatgggctttatcgagccattc
acaaaagagcttccgatggaatacgcagttgaaatgaaccgtttgattaagttcgaaatg
gaaggttctatcggttaa

DBGET integrated database retrieval system