KEGG   Bacillus subtilis subsp. subtilis 168: BSU32680Help
Entry
BSU32680          CDS       T00010                                 

Gene name
iscU
Definition
(RefSeq) NifU-like protein
  KO
K04488  nitrogen fixation protein NifU and related proteins
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    BSU32680 (iscU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NifU_N Moulting_cycle
Motif
Other DBs
NCBI-GeneID: 936702
NCBI-ProteinID: NP_391147
Pasteur: BG14008
BSORF: BG14008
UniProt: O32163
Structure
PDB: 

Position
complement(3357011..3357454)
Genome map
AA seq 147 aa AA seqDB search
MSFNANLDTLYRQVIMDHYKNPRNKGVLNDSIVVDMNNPTCGDRIRLTMKLDGDIVEDAK
FEGEGCSISMASASMMTQAIKGKDIETALSMSKIFSDMMQGKEYDDSIDLGDIEALQGVS
KFPARIKCATLSWKALEKGVAKEEGGN
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttaatgcaaacttagatacattgtacagacaggtgattatggatcattacaaa
aacccgcgaaataaaggggttttaaatgacagcattgtcgtggatatgaacaatccgaca
tgcggcgaccgcatcagactgacaatgaagcttgacggagacatcgtggaagatgcgaag
tttgaaggggaaggctgttccatttcaatggcatccgcttcgatgatgactcaggcgatt
aaagggaaagatattgaaactgccctttccatgtctaagattttctcggatatgatgcaa
gggaaagagtatgatgattctatagatctcggggatattgaagcccttcaaggcgtttca
aaattccctgcccgtatcaaatgtgcaaccctgtcatggaaagcacttgaaaaaggagtc
gcgaaagaagaaggcggcaattaa

DBGET integrated database retrieval system