KEGG   Bacillus subtilis subsp. subtilis 168: BSU32690Help
Entry
BSU32690          CDS       T00010                                 

Gene name
sufS
Definition
(RefSeq) cysteine desulfurase
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00450  Selenocompound metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BSU32690 (sufS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     BSU32690 (sufS)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     BSU32690 (sufS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 937108
NCBI-ProteinID: NP_391148
Pasteur: BG14009
BSORF: BG14009
UniProt: O32164
Structure
PDB: 

Position
complement(3357444..3358664)
Genome map
AA seq 406 aa AA seqDB search
MNITDIREQFPILHQQVNGHDLVYLDSAATSQKPRAVIETLDKYYNQYNSNVHRGVHTLG
TRATDGYEGAREKVRKFINAKSMAEIIFTKGTTTSLNMVALSYARANLKPGDEVVITYME
HHANIIPWQQAVKATGATLKYIPLQEDGTISLEDVRETVTSNTKIVAVSHVSNVLGTVNP
IKEMAKIAHDNGAVIVVDGAQSTPHMKIDVQDLDCDFFALSSHKMCGPTGVGVLYGKKAL
LENMEPAEFGGEMIDFVGLYESTWKELPWKFEAGTPIIAGAIGLGAAIDFLEEIGLDEIS
RHEHKLAAYALERFRQLDGVTVYGPEERAGLVTFNLDDVHPHDVATVLDAEGIAVRAGHH
CAQPLMKWLDVTATARASFYLYNTEEEIDKLVEALQKTKEYFTNVF
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcacagatattcgtgaacagttcccgatccttcatcagcaagtgaacggacat
gatctcgtttatctcgacagcgcggcgacttcccagaagccgcgtgctgtcattgaaaca
ctggataagtattataaccaatacaattccaatgttcaccggggcgtccatacacttgga
accagagcgacagatggttatgaaggagcgcgtgaaaaagtccgcaagtttattaacgcg
aagtcaatggctgagattattttcacaaaaggcacgaccacatcactgaatatggtggcg
ttaagctatgcgcgcgccaacctgaaacctggtgatgaagtggtcatcacctacatggag
catcatgcgaatatcattccgtggcagcaggctgtaaaagcaactggcgccacattaaaa
tatattccgttgcaggaagacggaacgatttctttagaagacgtcagagaaacggtcaca
agcaacacaaaaattgttgcggtgtctcatgtatctaatgttctcggcacggtcaacccg
attaaagaaatggcgaaaatcgctcatgacaatggggctgtcattgtggtggacggtgca
caaagcacgcctcacatgaaaattgacgtgcaggatctcgattgcgacttctttgcgctt
tcttcccataaaatgtgcggacctaccggtgttggtgtgctgtacggaaagaaagccctg
ctggaaaacatggagcctgccgaattcggcggtgaaatgatcgactttgtcgggctttat
gaatcaacttggaaagagcttccgtggaaattcgaagcgggtacgccgattattgcagga
gcaatcggcctcggtgccgccattgattttctcgaagaaatcggtcttgatgagatttcc
cgccatgagcacaagcttgcagcttatgcgcttgaacgcttccgccagcttgacggcgta
acggtttacgggccggaagagcgtgccgggcttgtcacatttaaccttgatgatgttcat
ccgcacgatgtggcgactgtgcttgatgcggagggaatcgcagtcagagccggccaccat
tgtgcgcagccgctgatgaaatggctggatgtaactgctactgcaagagcaagcttttat
ctgtataatacagaggaagagattgataagcttgtggaagctcttcaaaagacaaaggag
tattttacaaatgtcttttaa

DBGET integrated database retrieval system