KEGG   Bacillus subtilis subsp. subtilis 168: BSU32700Help
Entry
BSU32700          CDS       T00010                                 

Gene name
sufD
Definition
(RefSeq) FeS cluster assembly protein SufD
  KO
K09015  Fe-S cluster assembly protein SufD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU32700 (sufD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0051
Motif
Other DBs
NCBI-GeneID: 938871
NCBI-ProteinID: NP_391149
Pasteur: BG14010
BSORF: BG14010
UniProt: O32165
Position
complement(3358664..3359977)
Genome map
AA seq 437 aa AA seqDB search
MTLGTKLSVDQEYLKSFSEKHQEPAWLKNLRLQALEQAEDLPMPKPDKTKITNWNFTNFA
KHTVDNEPLSSLEDLTDEVKALIDIENEDKTLYVQRDQTPAHLSLSQELKDKGVIFTDIL
TAAREHSDLVEKYFMKDGVKVDEHKLTALHAALVNGGAFLYVPKNVQVETPVQAVYVHES
NDTALFNHVLIVAEDHSSVTYVENYISTVNPKDAVFNIISEVITGDNASVTYGAVDNLSS
GVTTYVNRRGAARGRDSKIEWALGLMNDGDTISENTTNLYGDGTYGDTKTVVVGRGEQTE
NFTTQIIHFGKASEGYILKHGVMKDSASSIFNGIGKIEHGASKANAEQESRVLMLSEKAR
GDANPILLIDEDDVTAGHAASVGRVDPIQLYYLMSRGIPKEEAERLVIYGFLAPVVNELP
IEGVKKQLVSVIERKVK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacactaggtacaaaactatccgtagatcaggagtatctcaaaagcttttccgaaaag
caccaagaacctgcctggctgaagaacctgcgcttacaggctcttgaacaagctgaggat
ctgccgatgccgaaacctgacaaaacaaaaatcacaaactggaacttcacgaatttcgcg
aagcatacagtggataacgaaccgctttcttcattagaagatttgactgatgaagtaaaa
gcgctgatcgacattgaaaacgaagataaaacattatacgtacagcgtgaccagacgccg
gcacatctttctctttctcaagaattgaaagacaaaggcgtcatcttcactgatattctg
actgctgcacgcgagcacagcgacttggtggagaaatactttatgaaggacggcgtgaag
gttgacgaacataagttaactgcacttcacgcggctcttgttaacggaggagcattcctt
tatgttccgaaaaatgttcaggtggagacgccggttcaggctgtttatgtccacgaaagc
aatgatacagctctattcaaccacgtgctgattgtggctgaagaccacagctctgtaaca
tatgtagaaaactacatcagcactgtaaacccgaaagacgctgtcttcaatattatcagt
gaggtcatcacaggtgataatgccagcgtgacatacggtgcggtggataatctgtcaagc
ggtgtgacaacttatgtgaaccgccgcggtgctgcgcgcggacgcgacagcaaaatcgag
tgggctctcggcctgatgaacgatggcgacacgatttccgaaaacacaacaaacctttac
ggtgacggcacatacggcgatacgaaaacggttgttgtcggaagaggagagcaaacagaa
aacttcacaacacaaatcatccatttcggtaaagcttctgaaggctatatcttgaagcac
ggtgtgatgaaggattccgcttcttctatctttaacggaatcggcaaaatcgaacatggc
gcttctaaagcgaatgcggagcaagaatcacgcgtgctgatgcttagcgaaaaagcacgc
ggagacgcaaaccctattcttttaattgacgaagacgatgtaactgcaggacatgcggca
tctgtcggccgtgtggaccctattcagctttactacctgatgagccgcggaattccgaaa
gaagaagcagaacgcttagtcatttacggattccttgcaccggtagtaaatgaacttccg
attgaaggcgttaagaaacaattagtttctgttatcgaaaggaaagtgaagtaa

DBGET integrated database retrieval system