KEGG   Bacillus subtilis subsp. subtilis 168: BSU32710
Entry
BSU32710          CDS       T00010                                 

Symbol
sufC
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K09013  Fe-S cluster assembly ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32710 (sufC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Orphan ABC ATPase
    BSU32710 (sufC)
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA AAA_27 AAA_29 DUF1439 RsgA_GTPase AAA_28 AAA_13 AAA_22 Glyco_trans_4_2 AAA_33 AAA_25 AAA_23
Other DBs
NCBI-GeneID: 937073
NCBI-ProteinID: NP_391150
Pasteur: BG14011
BSORF: BG14011
UniProt: P80866 A0A6M3ZFU3
Position
complement(3359995..3360780)
AA seq 261 aa
MAASTLTIKDLHVEIEGKEILKGVNLEIKGGEFHAVMGPNGTGKSTLSAAIMGHPKYEVT
KGSITLDGKDVLEMEVDERAQAGLFLAMQYPSEISGVTNADFLRSAINARREEGDEISLM
KFIRKMDENMEFLEMDPEMAQRYLNEGFSGGEKKRNEILQLMMIEPKIAILDEIDSGLDI
DALKVVSKGINKMRSENFGCLMITHYQRLLNYITPDVVHVMMQGRVVKSGGAELAQRLEA
EGYDWIKQELGIEDETVGQEA
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctgcttcaacattaacgatcaaagatcttcacgttgaaatcgaagggaaagagatc
ttaaagggtgtaaaccttgaaataaaaggtggagaattccacgcagtaatgggcccgaac
ggaactggtaaatccactttatcagctgctattatggggcatcctaaatatgaagtaaca
aaaggcagcatcacgcttgacggcaaagatgtactggagatggaagtggacgagcgtgcg
caggcaggcttattccttgcaatgcagtacccaagtgaaatcagcggtgtgacaaatgcc
gacttccttcgctcagcaatcaacgcgcgcagagaagaaggcgatgaaatttctctcatg
aaattcatccgcaaaatggacgaaaacatggagttccttgaaatggaccctgaaatggct
cagcgctatcttaacgaaggcttctcaggcggggagaaaaaacgcaacgaaatccttcaa
ttaatgatgattgaaccgaaaatcgccatccttgatgaaattgactcaggccttgatatt
gacgctttgaaagttgtatcaaaagggatcaacaaaatgcgcagcgaaaacttcggctgc
ctgatgatcactcactatcagcgcctgttaaactacatcactccggatgttgttcacgtt
atgatgcaaggccgcgttgtaaaatccggcggtgcagagcttgcacagcgtcttgaagca
gaaggttatgactggatcaaacaagaacttggcattgaagacgaaactgttggccaagaa
gcgtaa

DBGET integrated database retrieval system