KEGG   Bacillus subtilis subsp. subtilis 168: BSU32719Help
Entry
BSU32719          CDS       T00010                                 

Gene name
yuzK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8303161
NCBI-ProteinID: YP_003097782
UniProt: C0H3Q9
Position
complement(3360974..3361111)
Genome map
AA seq 45 aa AA seqDB search
MEKAMQLSHGIGYEEYGRRLETRMKVERQRELDYEKSKRISAGAY
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcgatgcagctgtcacacggaattggatacgaggaatatggacgccggctg
gaaacaagaatgaaagtagagcggcagagagagcttgattatgaaaaaagcaagcggatt
tctgcgggagcttattga

DBGET integrated database retrieval system