KEGG   Bacillus subtilis subsp. subtilis 168: BSU32720Help
Entry
BSU32720          CDS       T00010                                 

Gene name
yurZ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD
Motif
Other DBs
NCBI-GeneID: 937080
NCBI-ProteinID: NP_391151
Pasteur: BG14012
BSORF: BG14012
UniProt: O32166
Position
complement(3361305..3361682)
Genome map
AA seq 125 aa AA seqDB search
MEGFSLNQDRGSMQDALKQYKHGLGTFEQKMPLMGRKFNEFTEQCFAGNSLTEREKQLIA
LGIAINAQDEYCMIYHTKGCLDQGASEENILEAVSVAAAFGGGAAFSQGVTVVQQCIEEF
GNTTH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggagggattttctttgaatcaagacagaggaagcatgcaggacgcgttaaaacaatat
aaacatggtttaggcacatttgaacaaaagatgccgctgatgggaagaaaatttaacgaa
tttactgaacagtgctttgccgggaattctctgactgaaagagaaaaacagctgatcgcc
ctcggaattgccatcaatgctcaggacgaatattgcatgatctatcatacaaaaggctgt
cttgatcagggagcgtcagaagaaaacattctcgaagccgtcagtgtggcagcggcattt
ggaggcggcgcagctttcagccaaggcgtgacagtcgttcaacagtgcattgaggaattc
ggaaacaccacgcattaa

DBGET integrated database retrieval system