KEGG   Bacillus subtilis subsp. subtilis 168: BSU32730Help
Entry
BSU32730          CDS       T00010                                 

Gene name
metN
Definition
(RefSeq) methionine-binding lipoprotein MetQ
  KO
K02073  D-methionine transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU32730 (metN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32730 (metN)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238]
    BSU32730 (metN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_9 SBP_bac_11 Phosphonate-bd ADAM_spacer1
Motif
Other DBs
NCBI-GeneID: 936716
NCBI-ProteinID: NP_391152
Pasteur: BG14013
BSORF: BG14013
UniProt: O32167
Structure
PDB: 

Position
complement(3361767..3362591)
Genome map
AA seq 274 aa AA seqDB search
MKKLFLGALLLVFAGVMAACGSNNGAESGKKEIVVAATKTPHAEILKEAEPLLKEKGYTL
KVKVLSDYKMYNKALADKEVDANYFQHIPYLEQEMKENTDYKLVNAGAVHLEPFGIYSKT
YKSLKDLPDGATIILTNNVAEQGRMLAMLENAGLITLDSKVETVDATLKDIKKNPKNLEF
KKVAPELTAKAYENKEGDAVFINVNYAIQNKLNPKKDAIEVESTKNNPYANIIAVRKGEE
DSAKIKALMEVLHSKKIKDFIEKKYDGAVLPVSE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagctatttttgggtgcattactgcttgtatttgcaggagttatggctgcctgc
ggttcgaataacggcgctgaatccggcaagaaagaaattgtcgttgcggcaacaaaaaca
ccgcatgcggaaattttaaaagaagctgaaccattgctgaaagaaaaaggctatacgctg
aaagtgaaagtgcttagtgattacaaaatgtacaataaagctttagctgataaagaagtg
gacgcgaactacttccagcacattccttaccttgagcaagaaatgaaagaaaacacagat
tacaaacttgtgaatgccggcgctgttcacttagagccattcggtatttactctaaaaca
tacaaatcactgaaagaccttccagacggtgcgacaatcattctgacaaacaacgttgct
gaacaaggccgtatgcttgcaatgcttgaaaacgctggattaatcactcttgattctaaa
gtggaaacagttgacgcaacattgaaagacattaagaaaaacccgaaaaaccttgaattc
aaaaaagtagcgcctgaattaacggcaaaagcatatgaaaacaaagaaggagacgcggtc
ttcatcaatgtaaactatgcgatccaaaataaattaaatcctaaaaaagacgcaattgaa
gtagaatcaacgaaaaacaacccatacgctaacatcatcgcagtaagaaaaggcgaagaa
gattctgcaaaaatcaaagcgctgatggaagttcttcactctaaaaagatcaaagacttc
atcgagaaaaaatacgacggagctgtgcttcctgtatctgaataa

DBGET integrated database retrieval system