KEGG   Bacillus subtilis subsp. subtilis 168: BSU32730
Entry
BSU32730          CDS       T00010                                 

Symbol
metN
Name
(RefSeq) methionine-binding lipoprotein MetQ
  KO
K02073  D-methionine transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU32730 (metN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32730 (metN)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   D-Methionine transporter
    BSU32730 (metN)
SSDB
Motif
Pfam: Lipoprotein_9 SBP_bac_11 Phosphonate-bd Ploopntkinase3
Other DBs
NCBI-GeneID: 936716
NCBI-ProteinID: NP_391152
Pasteur: BG14013
BSORF: BG14013
UniProt: O32167 A0A6M3ZFV3
Structure
PDB: 
4GOT

Position
complement(3361767..3362591)
AA seq 274 aa
MKKLFLGALLLVFAGVMAACGSNNGAESGKKEIVVAATKTPHAEILKEAEPLLKEKGYTL
KVKVLSDYKMYNKALADKEVDANYFQHIPYLEQEMKENTDYKLVNAGAVHLEPFGIYSKT
YKSLKDLPDGATIILTNNVAEQGRMLAMLENAGLITLDSKVETVDATLKDIKKNPKNLEF
KKVAPELTAKAYENKEGDAVFINVNYAIQNKLNPKKDAIEVESTKNNPYANIIAVRKGEE
DSAKIKALMEVLHSKKIKDFIEKKYDGAVLPVSE
NT seq 825 nt   +upstreamnt  +downstreamnt
ttgaaaaagctatttttgggtgcattactgcttgtatttgcaggagttatggctgcctgc
ggttcgaataacggcgctgaatccggcaagaaagaaattgtcgttgcggcaacaaaaaca
ccgcatgcggaaattttaaaagaagctgaaccattgctgaaagaaaaaggctatacgctg
aaagtgaaagtgcttagtgattacaaaatgtacaataaagctttagctgataaagaagtg
gacgcgaactacttccagcacattccttaccttgagcaagaaatgaaagaaaacacagat
tacaaacttgtgaatgccggcgctgttcacttagagccattcggtatttactctaaaaca
tacaaatcactgaaagaccttccagacggtgcgacaatcattctgacaaacaacgttgct
gaacaaggccgtatgcttgcaatgcttgaaaacgctggattaatcactcttgattctaaa
gtggaaacagttgacgcaacattgaaagacattaagaaaaacccgaaaaaccttgaattc
aaaaaagtagcgcctgaattaacggcaaaagcatatgaaaacaaagaaggagacgcggtc
ttcatcaatgtaaactatgcgatccaaaataaattaaatcctaaaaaagacgcaattgaa
gtagaatcaacgaaaaacaacccatacgctaacatcatcgcagtaagaaaaggcgaagaa
gattctgcaaaaatcaaagcgctgatggaagttcttcactctaaaaagatcaaagacttc
atcgagaaaaaatacgacggagctgtgcttcctgtatctgaataa

DBGET integrated database retrieval system