KEGG   Bacillus subtilis subsp. subtilis 168: BSU32740Help
Entry
BSU32740          CDS       T00010                                 

Gene name
metP
Definition
(RefSeq) methionine import system permease protein MetP
  KO
K02072  D-methionine transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU32740 (metP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32740 (metP)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238]
    BSU32740 (metP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF2407_C Mt_ATP-synt_B
Motif
Other DBs
NCBI-GeneID: 936709
NCBI-ProteinID: NP_391153
Pasteur: BG14014
BSORF: BG14014
UniProt: O32168
Position
complement(3362605..3363273)
Genome map
AA seq 222 aa AA seqDB search
MFEKYFPNVDLTELWNATYETLYMTLISLLFAFVIGVILGLLLFLTSKGSLWQNKAVNSV
IAAVVNIFRSIPFLILIILLLGFTKFLVGTILGPNAALPALVIGSAPFYARLVEIALREV
DKGVIEAAKSMGAKTSTIIFKVLIPESMPALISGITVTAIALIGSTAIAGAIGSGGLGNL
AYVEGYQSNNADVTFVATVFILIIVFIIQIIGDLITNIIDKR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaaatacttcccgaacgttgatttaactgaattatggaacgcgacatatgaa
acactttatatgacgctgatttctttactgtttgcttttgtcatcggggtcatcctcggc
ttgctgctctttctgacgagcaaaggaagcctctggcagaataaagcggtcaactcagtg
attgcagccgttgttaacatattcagatcgattccgttccttattttaattattttacta
ttaggttttacgaaatttttagtcggcacgatcttagggccaaacgccgcattgccggcg
ctggtaatcggctcggcaccattttacgcgcgccttgttgaaatcgcgctgcgtgaggtg
gataaaggtgtgattgaagcagctaaatcaatgggcgcgaaaacgtctacgattattttc
aaagtgctgattccggaatcaatgcctgctcttatttctggcattacggttacagccatc
gctttaatcggttcaacggcaattgccggagccattggttcaggaggccttggaaacctt
gcgtacgtagaaggatatcagtctaataacgctgatgttaccttcgttgctactgtgttt
attttaatcatcgtgtttattattcaaatcatcggtgatctaataacaaatattatagac
aaacgataa

DBGET integrated database retrieval system