KEGG   Bacillus subtilis subsp. subtilis 168: BSU32750Help
Entry
BSU32750          CDS       T00010                                 

Gene name
metQ
Definition
(RefSeq) methionine import ATP-binding protein MetN
  KO
K02071  D-methionine transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU32750 (metQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32750 (metQ)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238]
    BSU32750 (metQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran NIL AAA_21 AAA_22 SMC_N RsgA_GTPase DUF2666 MMR_HSR1 AAA_16 NMT_C AAA_29 SbcCD_C
Motif
Other DBs
NCBI-GeneID: 936700
NCBI-ProteinID: NP_391154
Pasteur: BG14015
BSORF: BG14015
UniProt: O32169
Position
complement(3363266..3364291)
Genome map
AA seq 341 aa AA seqDB search
MINLQDVSKVYKSKHGDVNAVQNVSLSIKKGEIFGIIGYSGAGKSSLIRLLNGLEKPTSG
TVEVAGTKINEVNGRGLRKARHEISMIFQHFNLLWSRTVRDNIMFPLEIAGVKKSERIKR
ANELIKLVGLEGKEKSYPSQLSGGQKQRVGIARALANNPKVLLCDEATSALDPQTTDSIL
DLLSDINERLGLTIVLITHEMHVIRKICNRVAVMENGKVVEEGEVLDVFKNPKEQMTKRF
VQQVTEPEETKETLQHLLDDTASGKMVQLTFVGESAEQPLITEMIRNFNVSVNILQGKIS
QTKDGAYGSLFIHIDGDEEEVQNVIRFINDKQVKAEVITNV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaatcttcaggatgtttcaaaagtttacaagtcgaaacatggagatgtcaatgct
gtccaaaacgtctcgctttccattaaaaaaggtgagatttttggaattataggatatagc
ggagctggtaagagttccttaatccgtctgctgaacggccttgagaaaccaacctcagga
accgtggaagtggcgggaaccaagattaatgaagtaaatggacgcggtttaagaaaagca
cgccatgagatcagtatgattttccagcatttcaatttgctttggtcgcggactgtcaga
gataatatcatgtttcctttagaaattgccggggtgaaaaagagcgagcggatcaagcgc
gccaatgaactgattaaactggtaggtttagaaggaaaagaaaaatcttatccgtcccag
ctgagcggcggtcagaagcagcgtgtcggaattgccagagcgcttgcaaacaatccgaag
gttcttctttgtgacgaagcgacatcagcattagatccgcaaacgacagattcaattctg
gatctattgtccgatattaatgaaagactcggtttgacgattgtgctgattacgcacgaa
atgcatgtcatacgcaaaatctgcaacagagtcgccgtcatggaaaacggcaaggtggtc
gaagaaggcgaggttctcgatgtcttcaaaaatccaaaggaacaaatgacaaaacgattt
gttcaacaggtgacagagccggaagaaacgaaagagacgcttcagcaccttcttgatgat
acagcatcaggaaaaatggttcagctcacatttgtcggtgagtcagctgaacagcctctg
attacagagatgatcagaaacttcaatgtcagcgtcaatattctgcaagggaaaatttcg
cagacgaaggatggggcttacggttcactgttcatccacattgacggggacgaggaagaa
gtgcaaaacgtgatccgattcattaatgacaaacaggtgaaagcagaggtgatcacgaat
gtttga

DBGET integrated database retrieval system