KEGG   Bacillus subtilis subsp. subtilis 168: BSU32760Help
Entry
BSU32760          CDS       T00010                                 

Gene name
yusD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SCP2 Alkyl_sulf_C
Motif
Other DBs
NCBI-GeneID: 936713
NCBI-ProteinID: NP_391155
Pasteur: BG14016
BSORF: BG14016
UniProt: O32170
Position
complement(3364618..3364962)
Genome map
AA seq 114 aa AA seqDB search
MEKAEVLEDEYQHLFLKPLLNASTLLITFQGEAEALTVSINEQGEMKKVSPPQTSNLTFY
GNQTEIIDLLHGDISLQHLIQSGSLKVKGSFRALLKLEAILWLTNGFFQRILKN
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagcggaagttttagaagatgagtatcagcatctgtttttaaaaccccttttg
aatgcctcaacattgctcattaccttccaaggagaagcagaagccttaaccgtctcaata
aacgaacagggagaaatgaaaaaagtttctccgccccaaacgtccaacctgaccttttac
ggaaaccaaacggaaattattgatttattgcacggagacatttcccttcagcaccttatt
cagagcggaagcctcaaagtaaaggggtcattcagggccctgttaaagctggaagccatt
ctctggctgacaaatggattttttcagaggattttaaaaaattaa

DBGET integrated database retrieval system