KEGG   Bacillus subtilis subsp. subtilis 168: BSU32770Help
Entry
BSU32770          CDS       T00010                                 

Gene name
yusE
Definition
(RefSeq) thioredoxin
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_8 TraF Thioredoxin_2 TrbC_Ftype
Motif
Other DBs
NCBI-GeneID: 937184
NCBI-ProteinID: NP_391156
Pasteur: BG14017
BSORF: BG14017
UniProt: O32171
Position
complement(3365069..3365389)
Genome map
AA seq 106 aa AA seqDB search
MKELQEHELDHIEDDVYLLYLYTPFCGTCQLASKMLTVVKEMLPDVAFYQNNVNYSPTFA
KAYQIESVPCFLLFKGGKMVERGYAFHSVSYLYELIKQKSSSASHL
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaactccaagaacacgaacttgatcacattgaagatgatgtgtaccttctatat
ttatatactccgttttgcggcacctgccagcttgcaagcaaaatgctgacagtggtgaaa
gaaatgctgccggatgtcgccttctatcaaaacaatgtcaattactctccgacattcgca
aaagcgtatcaaattgaaagcgtcccttgttttctgctgtttaaaggcggaaagatggtc
gaaagaggatatgcatttcattccgtttcttatttatatgagctgatcaaacaaaaatca
tcttccgcatcccatttatga

DBGET integrated database retrieval system