KEGG   Bacillus subtilis subsp. subtilis 168: BSU32790Help
Entry
BSU32790          CDS       T00010                                 

Gene name
yusG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2553 MCR_D
Motif
Other DBs
NCBI-GeneID: 936719
NCBI-ProteinID: NP_391158
Pasteur: BG14019
BSORF: BG14019
UniProt: O32173
Position
complement(3365831..3366067)
Genome map
AA seq 78 aa AA seqDB search
MAFDKQKLDVTNDVTGRFQNGRLSLYHDNEMIGQMTSMNEYELKSGYSFENEKFYKTADV
VSGDDAKYVDCDYENGWC
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgacaaacaaaagctcgatgtcaccaatgacgtgacaggccgctttcaaaat
ggccggctctcgttatatcatgataatgagatgatcggccaaatgacaagcatgaatgaa
tatgagcttaagtccggttattcctttgaaaatgagaaattttataagacagccgatgtg
gtctctggagacgacgcaaaatatgtagattgtgactacgaaaacggctggtgttaa

DBGET integrated database retrieval system