KEGG   Bacillus subtilis subsp. subtilis 168: BSU32800Help
Entry
BSU32800          CDS       T00010                                 

Gene name
yusH
Definition
(RefSeq) glycine cleavage system H protein
  KO
K02437  glycine cleavage system H protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU32800 (yusH)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU32800 (yusH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_H Biotin_lipoyl
Motif
Other DBs
NCBI-GeneID: 936724
NCBI-ProteinID: NP_391159
Pasteur: BG14020
BSORF: BG14020
UniProt: O32174
Position
complement(3366123..3366506)
Genome map
AA seq 127 aa AA seqDB search
MSIPKDLRYSGEHEWVKVEGEKARIGITHFAQSELGDIVFVELPEVGAEIKADEPFGSVE
SVKTVSELYAPINGTVVEVNEDLDDSPEFVNESPYEKAWMIVVEPSDASEIEKLMTAEQY
EEMTQED
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
ttgagcataccaaaagatttgcgttactcaggagaacacgagtgggtaaaagttgaagga
gaaaaagccagaatcggaattacgcattttgcccagtccgaactaggcgacatcgtgttt
gtcgaacttcctgaagtgggcgctgaaatcaaagcggacgagccattcggcagtgttgaa
tccgttaaaacggtatctgagctttatgcaccgattaacggaacggttgtggaagtaaac
gaagatcttgatgacagtccggaattcgtcaacgaatctccgtacgaaaaagcatggatg
atcgtcgttgagccatctgacgcttctgaaattgaaaaactgatgacagcagagcaatac
gaagagatgacacaagaagactaa

DBGET integrated database retrieval system