KEGG   Bacillus subtilis subsp. subtilis 168: BSU32810Help
Entry
BSU32810          CDS       T00010                                 

Gene name
yusI
Definition
(RefSeq) hypothetical protein
  KO
K00537  arsenate reductase (glutaredoxin) [EC:1.20.4.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU32810 (yusI)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     BSU32810 (yusI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArsC Glutaredoxin DUF836
Motif
Other DBs
NCBI-GeneID: 936722
NCBI-ProteinID: NP_391160
Pasteur: BG14021
BSORF: BG14021
UniProt: O32175
Position
complement(3366573..3366929)
Genome map
AA seq 118 aa AA seqDB search
MSLTFYWYPKCGTCRKAKKWLEEHGKEINEIHIAEQPPSKEELKALYEKSGLDLKKFFNT
SGMKYRELNLKEKLYHMSEDEQLELLASDGMLIKRPLTTDGEKVTVGFKEDQFEENWA
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttaactttttactggtaccctaaatgcggaacgtgccgcaaagcaaagaagtgg
cttgaagagcatgggaaagaaataaacgaaatacatattgctgagcagccgccaagcaaa
gaagaattaaaagcgctttatgaaaaaagcgggctggatctcaagaaatttttcaacacg
agcggcatgaaataccgcgagctcaatctcaaggaaaagctgtatcatatgtcagaggac
gaacagctcgaactgctggcttcagatggtatgctaattaaacgcccgcttacaacagac
ggcgaaaaagtgactgtcggatttaaagaagaccaatttgaagaaaactgggcttaa

DBGET integrated database retrieval system