KEGG   Bacillus subtilis subsp. subtilis 168: BSU32820Help
Entry
BSU32820          CDS       T00010                                 

Gene name
fadE
Definition
(RefSeq) acyl-CoA dehydrogenase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 936717
NCBI-ProteinID: NP_391161
Pasteur: BG14022
BSORF: BG14022
UniProt: O32176
Position
complement(3367040..3368824)
Genome map
AA seq 594 aa AA seqDB search
MAKKAADVQKGGGFLIEDVTYDQMYTPEDFTDEHKMIAKTTEDYIEQDVLPHIDDIENHQ
FEHSVRLLKKAGELGLLGADVPEEYGGLGLDKISSALITEKFSRAGSFSLSYGAHVGIGS
LPIVFFGSEEQKKKYLPGLASGEKIAAYALTEPGSGSDALGAKTTAVLNEAGTHYVLTGE
KQWITNSAFADVFVVYAKVDGDKFSAFIVEKEFPGVSTGPEEKKMGIKGSSTRTLILDQA
EVPKENLLGEIGKGHVIAFNILNIGRYKLAVGTIGASKRVIELSAAYANQRRQFKTPIAG
FSLTQEKIGTMASRLYAMESSVYRTVGLFEDNMSQFTAEDLKDGRQIAKSIAEYAIECSL
NKVFGSETLDYIVDEGVQIHGGYGFMQEYEVERAYRDSRINRIFEGTNEINRLIVPSTFL
KKALKGELPLFEKAQSLQEELMMLMPEEPGSGVLEQEKYIVKQAKKIALFAAGLAAQKYG
KAIDREQEILVNVADIVSNVYAMESAVLRTEKAIAAQGAEKAAQKVLYTEIFVQEAFNEI
EAHAKESLIAMEEGDSLRMMLSALRKLTRVTPKNVIQKKREAAAGIFEAEKYTV
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaagcggctgacgtacaaaaaggcggcggatttttaatcgaggatgtcaca
tacgatcaaatgtatacaccggaggatttcactgacgagcataaaatgattgcgaaaaca
acagaggattacatcgagcaagatgttctccctcatatagatgatatcgaaaaccatcaa
ttcgagcattctgtcagactgttgaagaaagcgggcgaactagggctgcttggcgccgat
gtgccggaagaatacggcgggctcggccttgataaaatcagctcggcactcatcactgag
aaattttcgcgtgcgggaagcttttctctttcttatggcgcgcatgtcggtatcggttcc
ttgccgatcgtctttttcgggtcagaagaacaaaagaaaaaatatttgcctggactcgct
tcaggcgaaaagatcgccgcttatgctctgactgagcctggctctgggtctgatgcactt
ggagcaaaaacaacagctgtgctgaatgaagcaggaacccattatgtattaacaggggaa
aaacagtggattaccaactctgcttttgccgatgtatttgtagtttacgctaaggtagac
ggcgacaagttttcagcctttattgtagaaaaagagttcccgggtgtctccacgggaccg
gaagaaaagaaaatgggaatcaagggatcatcgacaagaaccctcattctggatcaagct
gaagtgccaaaggaaaacctgctcggagaaatcggcaaagggcatgtcatcgcctttaat
attttaaacatcggccgttacaaactggcggttggcacaatcggcgcatctaaacgcgtc
atcgagctgtctgcggcatacgcaaatcagcgccgccaatttaaaacgccgattgctggt
ttttcattgacacaggaaaaaatcgggacaatggcctcaaggctgtatgcgatggaaagc
tctgtatacagaaccgtcgggctgtttgaagacaatatgagccagttcacggccgaagat
ctcaaggacggccggcaaatcgccaaatcgattgcggaatacgccatcgaatgctctctg
aataaggtattcggctctgaaacgcttgattatatcgttgatgaaggcgtgcagattcat
ggaggctacggctttatgcaggaatacgaagtagaaagggcctatagggattcaaggatc
aatcggatttttgaaggcacaaacgaaatcaaccggttaatcgtgccaagcaccttcctg
aaaaaagcgcttaaaggcgagctgcctttattcgaaaaagcgcagtcgctgcaggaagaa
ctcatgatgcttatgcctgaagagcctggaagcggcgtcttagagcaggagaaatatatc
gtcaagcaagccaaaaaaattgcgttgtttgctgccggcctagccgcgcaaaaatacgga
aaagcgatcgatcgtgagcaagaaattctcgtgaacgtagcggatatcgtcagcaatgta
tacgcaatggaatcagccgtgctcagaacggaaaaggccattgccgcacaaggcgctgaa
aaagcagcgcaaaaggtgctgtacacagaaattttcgttcaagaggcctttaacgaaatc
gaagcgcatgcaaaggaatcccttatcgcaatggaagaaggagattcactccgcatgatg
ctttccgctctgcgcaagctgacacgcgtaacgcctaaaaacgtgattcagaaaaaacgc
gaggcggcggcaggcatttttgaggctgagaaatatactgtctga

DBGET integrated database retrieval system