KEGG   Bacillus subtilis subsp. subtilis 168: BSU32830
Entry
BSU32830          CDS       T00010                                 

Symbol
yusK
Name
(RefSeq) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00071  Fatty acid degradation
bsu00280  Valine, leucine and isoleucine degradation
bsu00281  Geraniol degradation
bsu00362  Benzoate degradation
bsu00592  alpha-Linolenic acid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSU32830 (yusK)
   00592 alpha-Linolenic acid metabolism
    BSU32830 (yusK)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU32830 (yusK)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    BSU32830 (yusK)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSU32830 (yusK)
   00642 Ethylbenzene degradation
    BSU32830 (yusK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     BSU32830 (yusK)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF5708
Other DBs
NCBI-GeneID: 936729
NCBI-ProteinID: NP_391162
Pasteur: BG14023
BSORF: BG14023
UniProt: O32177 A0A6M3ZGH3
Position
complement(3368839..3370014)
AA seq 391 aa
MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEGNIDDLIIGCATPE
AEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAESM
SQVPMMGHVTRPNLALAEKAPEYYMSMGHTAEQVAKKYGVSREDQDAFAVRSHQNAAKAL
AEGKFKDEIVPVEVTVTEIGEDHKPMEKQFVFSQDEGVRPQTTADILSTLRPAFSVDGTV
TAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEAIPRALK
LAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGTKLTLSL
IHEMKRRNEQFGVVTMCIGGGMGAAGVFELC
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgaaagaggcagtcattgtgtcaggtgcaagaacaccggttggaaaagcaaaaaaagga
tcgttggccaccgttcgcccggatgatttgggagcgatttgtgtaaaagaaacgctgaaa
cgggcaggcggctacgaaggcaatattgatgacttgattatcggctgtgcaacacctgaa
gcggagcaggggcttaatatggcgagaaatatcggtgcgctcgcgggcctgccgtacacg
gttccggcgattacagttaaccgctattgctcttcaggccttcagtctattgcgtatgca
gcagaaaaaattatgctgggcgcctacgatacagcgatcgccggcggagcagaatccatg
tcgcaagttccgatgatggggcatgttacccgtccgaaccttgctttggcagaaaaggca
ccggaatattatatgagcatggggcacacagccgagcaagtcgcgaaaaaatacggcgtc
tcccgtgaggatcaagacgcgtttgccgttcgcagccatcaaaacgccgctaaagccctt
gcagaaggaaaatttaaagatgaaattgtacccgtcgaagtgacggtgacagaaatcgga
gaagaccataagcctatggaaaaacagtttgtgttttctcaggatgaaggtgttcgcccg
caaacgactgcagacatcttatcgacattgcgcccggccttttccgttgacgggacggtg
actgcgggcaattcctcacaaacgagtgacggagcggcggctgtcatgctgatggaccgg
gaaaaagccgatgctcttggcctggcgccgcttgtgaaattccgctcctttgcggtaggc
ggcgtgccgccggaagtgatgggaatcggaccggtggaagcgattccgcgcgctttgaag
cttgccggacttcagctgcaggacatcggcttgtttgaactgaatgaagcttttgcctca
caggccattcaagtaatcagggaattgggaattgatgaagaaaaagtgaatgtcaacggg
ggcgcaatcgcgcttggacacccgcttggctgtacgggcacaaagcttacactctcactc
atccatgaaatgaaacggagaaacgagcaatttggagtcgtgaccatgtgtatcggcggc
ggaatgggagcggccggtgtatttgaattatgctaa

DBGET integrated database retrieval system