KEGG   Bacillus subtilis subsp. subtilis 168: BSU32840Help
Entry
BSU32840          CDS       T00010                                 

Gene name
fadN
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00071  Fatty acid degradation
bsu00362  Benzoate degradation
bsu00650  Butanoate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU32840 (fadN)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSU32840 (fadN)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSU32840 (fadN)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BSU32840 (fadN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA DUF3298 Lipase_GDSL_3 Pyr_redox_2 2-Hacid_dh_C DUF4342
Motif
Other DBs
NCBI-GeneID: 937125
NCBI-ProteinID: NP_391163
Pasteur: BG14024
BSORF: BG14024
UniProt: O32178
Position
complement(3370025..3372472)
Genome map
AA seq 815 aa AA seqDB search
MKEETGFIFFSQKMNDYSFNVQGGYLMHKHIRKAAVLGSGVMGSGIAAHLANIGIPVLLL
DIVPNDLTKEEEKKGLTKDSSEVRSRLSRQAMKKLLKQKPAPLTSAKNTSYITPGNLEDD
AEKLKEADWIIEVVVENLEVKKKIFALVDEHRKTGSIVSSNTSGISVQEMAEGRSDDFKA
HFLGTHFFNPARYLKLLEIIPIKETDPDILKFMTAFGENVLGKGVVTAKDTPNFIANRIG
TYGLLVTVQEMLKGGYQVGEVDSITGPLIGRPKSATFRTLDVVGLDTFAHVARNVYDKAD
GDEKEVFRIPSFMNDMLEKGWIGSKAGQGFYKKEGKTIYELDPVTLTYGERTKMKSPALE
AAKQAKGTKAKMKALIYSDDRAGRLLWNITSQTLLYSAELLGEIADDIHAIDQAMKWGFG
WELGPFEMWDAIGLKQSAEKLEQLGADMPGWIKEMLDKGNETFYIKENGTVFYYDRGEYR
AVKENKKRIHLQALKETKGVIAKNSGASLIDLGDDVALLEFHSKSNAIGLDIIQMIHKGL
EETERNYKGLVIGNQGKNFCVGANLAMILMEVQDDNFLEVDFVIRRFQETMMKIKYSAKP
VVAAPFGMTLGGGTEACLPAARIQAASEAYMGLVESGVGLIPGGGGNKELYINHLRRGHD
PMNAAMKTFETIAMAKVSASAQEAREMNILKETDQISVNQDHLLYDAKQLAASLYDTGWR
PPVKEKVKVPGETGYAALLLGAEQMKLSGYISEHDFKIAKKLAYVIAGGKVPFGTEVDEE
YLLEIEREAFLSLSGEAKSQARMQHMLVKGKPLRN
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagaaacgggtttcattttttttagtcaaaaaatgaatgactattcattcaat
gttcaagggggatatctcatgcacaaacacattcggaaggcagccgttttaggatcgggg
gtaatgggttccgggatagcggcgcatttggctaacatcggaattcctgtcctgctgcta
gatattgtgccgaacgatttgacaaaggaagaggaaaaaaaggggctgacgaaggacagt
tcggaggtgcgcagcaggctgagccggcaggcgatgaaaaaactgctgaaacaaaagccc
gctcccctcacatcagcgaaaaatacctcctatattacacctggcaatctggaggatgat
gcagaaaaactgaaagaagcagattggattattgaggtcgttgtcgaaaaccttgaagtc
aaaaagaaaattttcgctcttgtggatgaacatcgaaagactggaagcatcgtctcaagc
aacacatccggcatatcagtgcaggaaatggctgaaggccggtcggatgattttaaagcc
cattttcttggaacgcatttttttaatcccgcacgatatttaaagctgctagagatcatt
ccgattaaggaaacggatcctgatattttaaagtttatgacagctttcggagaaaatgtc
ctcgggaaaggcgttgttacagcaaaggacacaccgaactttatcgcaaaccgcatcggg
acttacgggcttctcgtgacagtccaagaaatgctgaaaggcggttatcaggtcggggag
gttgattcgatcacaggaccgctgatcggcaggccgaaaagcgccacctttagaacgctt
gatgtggtcggcctcgatacattcgcccacgttgcccgaaatgtgtatgacaaagctgat
ggcgatgaaaaagaagtgtttcgcattccaagcttcatgaacgatatgctggaaaaaggg
tggatcggaagcaaggccggccaaggcttttataaaaaagaaggaaaaacgatttatgag
cttgacccagtgacgcttacttacggcgagcggacaaaaatgaaatcaccggcacttgaa
gcggcaaaacaggcaaaagggacaaaagccaaaatgaaagcgcttatttattcggatgac
agggccggccgtttgctgtggaatatcacttctcaaaccctgctttactcagccgagctg
cttggcgagattgccgatgatattcatgcgattgaccaagccatgaagtggggattcggc
tgggaactgggaccttttgagatgtgggacgccatcggcctcaagcagtcagcggaaaag
cttgagcagcttggagcagatatgcctggctggataaaagagatgctggacaaaggaaat
gaaaccttctacatcaaagagaacggaacggtattttattatgaccgcggcgaatacaga
gccgtgaaagaaaacaaaaaacgaattcatttacaagcacttaaagaaacaaaaggcgtg
attgcgaaaaacagcggagcaagcttaattgaccttggagatgatgtggcccttcttgaa
tttcattcgaaaagcaatgcgatcggcctcgatatcattcaaatgatccacaaaggatta
gaggaaacagaacggaattacaaggggcttgtcatcggcaatcaagggaaaaatttctgc
gtcggcgcgaatctcgccatgatcttaatggaagtccaagatgacaactttttggaagtt
gattttgtgatccgccgttttcaggagacgatgatgaagatcaaatacagtgcgaaaccg
gtcgtcgccgcgccatttggcatgacgctcggcggaggaacggaagcatgcctgccggcg
gcgcgcattcaagcggcaagcgaagcctatatgggacttgtggaatccggtgtcggcctc
atccctggcggaggaggtaacaaagagctgtacatcaaccatcttcgccgcggccatgat
ccgatgaatgcggcaatgaaaacatttgaaacaatcgcgatggcgaaagtgtccgcttcc
gctcaagaggctcgtgagatgaacatcttaaaagaaacggatcagatcagcgtgaatcaa
gaccacctgttatacgatgcgaagcagctggccgcatctttatacgataccggctggcgg
ccgcctgtaaaagaaaaggtcaaggtgccgggagaaaccggttatgcggcactcttgctt
ggcgctgagcagatgaagctgtccggctatatatctgagcatgattttaagatcgcgaaa
aaactcgcttatgtcattgcgggcggaaaagtgccgtttggtacagaggttgatgaagag
tatttattggagatcgaaagagaagcgtttttgagtttgtcaggagaggcaaaatctcaa
gcgagaatgcagcatatgcttgtgaaaggtaaacctttacggaattag

DBGET integrated database retrieval system