KEGG   Bacillus subtilis subsp. subtilis 168: BSU32859Help
Entry
BSU32859          CDS       T00010                                 

Gene name
yuzM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8302981
NCBI-ProteinID: YP_003097784
UniProt: C0H3R1
Position
3373743..3373988
Genome map
AA seq 81 aa AA seqDB search
MDNQQQSQMPPSVISTKDHLYLNDMLNWNLLAMKKAHFMAQQCQDQTLKQELDRVGHMHH
DHYQRILKHLQPGQQQSGYIQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggataatcagcagcaatctcaaatgccgccttccgttatttcgacaaaggatcatttg
tatctcaatgacatgctgaactggaatttgctcgcgatgaaaaaagcgcatttcatggcg
cagcagtgccaggatcaaacgttaaagcaagaactcgaccgcgtcggacacatgcatcat
gatcactatcaaagaatattaaagcacctgcagccaggccagcagcagtccggctacatc
caataa

DBGET integrated database retrieval system