KEGG   Bacillus subtilis subsp. subtilis 168: BSU32860Help
Entry
BSU32860          CDS       T00010                                 

Gene name
yusN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coat_F Nore1-SARAH
Motif
Other DBs
NCBI-GeneID: 937194
NCBI-ProteinID: NP_391165
Pasteur: BG14026
BSORF: BG14026
UniProt: O32180
Position
3374001..3374333
Genome map
AA seq 110 aa AA seqDB search
MNQQNQKISNPQTPVPTTSEMNDRDFVNELLTTEKYMTTAYCTALHEFSHESLYQDIQSI
FDESQKAQRKLYDLMFQYGWYSVEAEDSQKLQQSYQKFQQTIQQQSPYQQ
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcaaaatcaaaaaatcagcaacccgcagacacctgtaccgacaacatcggaa
atgaatgacagagatttcgtcaacgaattgctgacaaccgaaaaatacatgacaacagct
tattgcactgccttgcacgaattcagccacgagtctctttatcaggatattcaatccatt
tttgatgagtcacaaaaagcgcaaagaaaactatatgatctcatgttccaatatggatgg
tattctgttgaagcggaggattcacaaaagctgcagcagtcctatcaaaaattccagcag
accattcagcagcagtctccttatcagcaataa

DBGET integrated database retrieval system