KEGG   Bacillus subtilis subsp. subtilis 168: BSU32870Help
Entry
BSU32870          CDS       T00010                                 

Gene name
yusO
Definition
(RefSeq) HTH-type transcriptional regulator YusO
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 Fe_dep_repress HTH_27 HTH_24 HTH_34 TrmB Penicillinase_R HTH_5 Rrf2 HTH_47 HTH_DeoR LexA_DNA_bind TnsD FeoC RdRP HxlR GntR HTH_IclR HTH_Crp_2
Motif
Other DBs
NCBI-GeneID: 935923
NCBI-ProteinID: NP_391166
Pasteur: BG14027
BSORF: BG14027
UniProt: O32181
Structure
PDB: 

Position
3374492..3374959
Genome map
AA seq 155 aa AA seqDB search
MKSADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGSLKVSEIAER
MEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYL
SFLTEEEMLQAAHITAKLAQAAETDEKQNMKRGNG
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtgcggatcagttaatgtccgatattcaattatcgcttcaggcgctctttcaa
aagatacagcctgaaatgctggaaagcatggagaaacaaggtgtcaccccagcgcagctg
tttgtgctggccagcctaaagaaacacggcagcctcaaagtttctgaaattgccgagcgt
atggaggtgaagccaagcgcggtgacgctgatggcagatcgccttgaacaaaaaaatctt
atcgccagaacacacaacacaaaagacaggcgagtgattgatctcagtcttactgacgaa
ggagacataaagttcgaggaggttttggcgggcagaaaagccataatggcgcgctatctt
tcctttttgacggaggaggaaatgctgcaggcggcgcatattacagcaaaactcgcacaa
gcagcagaaacggatgaaaagcaaaacatgaaaagaggaaacggatga

DBGET integrated database retrieval system