KEGG   Bacillus subtilis subsp. subtilis 168: BSU32880Help
Entry
BSU32880          CDS       T00010                                 

Gene name
yusP
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 TRI12 Sugar_tr OATP MFS_3 DUF4149 DUF2165
Motif
Other DBs
NCBI-GeneID: 937088
NCBI-ProteinID: NP_391167
Pasteur: BG14028
BSORF: BG14028
UniProt: O32182
Position
3374956..3376581
Genome map
AA seq 541 aa AA seqDB search
MKMSKEGKQSKRTLLITGLIIAMFFSALDGTIVGTAMPKIVGDLGGLSMMTWLTTAYLLT
STTIVPIAGKLADLLGRRIVYVSGLIIFMAASALCGMANNMTELIIFRGLQGIGGGIMMP
MAMIVIGDLFTGKQRAKFQGVFGAIYGLASVIGPQIGGWIVDSLNWKWVFYINLPVGIIA
VIFIARGLQGRQQTGPINFDIAGIFTMIVGVVSLLLALSFGGKDYAWDSWQILGLFALAL
IGIVSFIIVESKAKEPILPMYLFKNRTFTFLNLIGFFMSIGMFGAITFVPFFMQGIVGVS
ASESGTIMTPMMISMIITSIIGGQLVYKIGIKPQIITGMLVMAGGFLLLTTLDLDTSKLV
ATSFMAIIGLGMGLVMPILTLALQESFSKEELGVVTSSSQFFRSIGGTFGITMLGAVMNA
RSGNLLTDKLVPYLDSLPAQASSFAAQLKGMIDTNPQGLLQSLFSPDAVKQIPAAFSSHI
VPILKTSLMDSLHSVFYTGLIFIAVGAVFTLFLKPIKLSNKKAEDQQEKEKAAKAVESPS
H
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgagtaaagaaggcaaacaatcaaaacgaacgttattaataacaggcttaatt
attgccatgtttttttcagcccttgacggtaccattgtcggaacggccatgccgaaaatt
gtcggtgatctgggcggtttgagcatgatgacctggctgacaactgcatatttgttaaca
tcaacaaccattgttccaattgccggtaaactggctgatttattgggacgccgcattgtc
tatgtatcaggtttgattatttttatggccgcttctgctttgtgcggaatggccaacaac
atgacggaattgattatcttccgtggactgcagggcatcggcggaggcatcatgatgccg
atggcgatgattgtcatcggtgacttgttcacaggaaaacagcgtgctaaattccaaggt
gtctttggcgcaatttacgggctggcttcagtgattgggccgcaaatcggcggctggatt
gtagactcgttaaactggaaatgggttttctatattaacctgccagtcggaattattgcg
gttatttttattgccaggggattacagggacgccagcagactggtccgatcaacttcgat
atcgctggtattttcacaatgattgtcggtgtggtcagcctcctgctcgccttaagcttt
ggcggaaaagattatgcatgggattcatggcagattcttgggttgttcgctctcgcactg
atcggcattgtcagctttatcatcgtagaatcaaaagcaaaagagccaatcctgccaatg
tatttatttaaaaacagaacatttacatttctaaacttgatcggcttctttatgagtatc
ggtatgtttggcgccattacgtttgttcctttctttatgcagggaattgtcggtgtaagt
gcgtctgaatcgggtacaattatgacaccgatgatgatttctatgattatcacaagtatc
atcggcggacagcttgtttataaaattgggattaaaccgcaaatcattacaggcatgctg
gttatggccggcggattcctgctgttaacgacattggatctcgacacgagcaagcttgtc
gctacatcttttatggcgattattggtctgggaatgggtcttgttatgccgattctgaca
ttggctttacaggaaagcttttcgaaggaggagcttggagttgtcacttcatccagccaa
ttcttccgttctatcggcggaacattcggcattaccatgctgggagccgtaatgaatgcg
agatcaggaaatctattaacagataaattggttccatatttagactctcttccggcacag
gcaagctcgtttgccgcccagctaaagggtatgattgatacaaatccgcaagggctgctg
caatcactgttcagtccggacgcggtcaaacaaatccctgcggctttctcatcccatatt
gtgccgattttaaaaacatcgttgatggattcgctccacagcgtgttttatacgggcctg
atctttatcgcagtcggagccgtattcaccttgttcttaaaacctatcaagctatcaaat
aagaaagcggaagaccaacaagaaaaagagaaggcggcaaaagccgttgaatcaccttcc
cattaa

DBGET integrated database retrieval system