KEGG   Bacillus subtilis subsp. subtilis 168: BSU32890Help
Entry
BSU32890          CDS       T00010                                 

Gene name
yusQ
Definition
(RefSeq) tautomerase YusQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tautomerase_2 Tautomerase
Motif
Other DBs
NCBI-GeneID: 938468
NCBI-ProteinID: NP_391168
Pasteur: BG14029
BSORF: BG14029
UniProt: O32183
Position
complement(3376617..3377000)
Genome map
AA seq 127 aa AA seqDB search
MPFVQIHLRSGRSEVWLQKLSRTIHQSMIEEINVPEDDYFQVIRQYEKSEFFYDPFYLQV
ERTDELIYIHFTLKQSRTTEQKKALYRSIASRIHSELGVRKEDVFIMLAGNQDEDWSFGN
GRAQMIE
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgtacagattcatttacggtcgggaagaagcgaagtgtggcttcaaaaactg
agcaggactatccaccaatcgatgattgaagaaatcaatgtgccggaagatgactatttc
caagtcatcagacaatatgaaaaaagcgaatttttttatgatccattttatctccaagtc
gagcgtactgatgaactgatatacattcattttacactgaaacagtcaagaacaactgaa
cagaaaaaagcactttaccgctcaatcgcgagccggattcattccgagcttggtgtaaga
aaagaagatgtgtttatcatgctggccggaaatcaggatgaggattggtctttcggaaat
ggaagagcccagatgattgaataa

DBGET integrated database retrieval system