KEGG   Bacillus subtilis subsp. subtilis 168: BSU32900Help
Entry
BSU32900          CDS       T00010                                 

Gene name
yusR
Definition
(RefSeq) 3-oxoacyl-ACP reductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-GeneID: 937076
NCBI-ProteinID: NP_391169
Pasteur: BG14030
BSORF: BG14030
UniProt: O32184
Position
complement(3377019..3377408)
Genome map
AA seq 129 aa AA seqDB search
MKGMFFCARAVVPFMKKSKDGAIVNVGSIAGITGAGSSMPYAVSKSAVHGLTKSLAHALA
PEIRVSGVAPGAVATRWWAGREEKMKSMIGSLLLQCIAEPDDVAKLICSLIEQESLTGQI
ITIDSGQTL
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagggatgtttttctgcgcgcgggcagtggttccgttcatgaagaaaagcaaggac
ggggcgatcgtaaacgtcggcagcatcgcagggataactggtgccggctcatcaatgcct
tacgcagtatcaaaatcagcggtgcacggtttaacgaaatcattggcccacgccttagcg
cctgaaatcagagtgagcggtgtagcaccaggagctgtggcaacgagatggtgggccgga
cgggaagaaaaaatgaaaagcatgatcggctctttgctgctgcagtgtattgctgaacca
gatgatgttgccaaattgatttgttcactaattgaacaggaatcactcacaggccaaatt
atcacaattgacagcggacagacgctgtaa

DBGET integrated database retrieval system