KEGG   Bacillus subtilis subsp. subtilis 168: BSU32910
Entry
BSU32910          CDS       T00010                                 

Symbol
yusS
Name
(RefSeq) short-chain dehydrogenase/reductase YusS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short adh_short_C2 KR YjeF_N THF_DHG_CYH_C Peripla_BP_6 Epimerase
Other DBs
NCBI-GeneID: 935924
NCBI-ProteinID: NP_391170
Pasteur: BG14031
BSORF: BG14031
UniProt: O32185
Position
complement(3377430..3377759)
AA seq 109 aa
MNVLNKIALVTGGGTGIGKAASMELAKRGAIVAVNYSRSQSEAEETVEMIQKAGGQAFAI
QADVSKNSDVQDMIQAIVNTHGTVDILVNNASITRHIPMDDLEAATEDV
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaatgtcttgaacaaaatagctctcgtaacggggggcggcacaggaatcggaaaagca
gccagtatggaattggcaaagcgtggggcgattgtggcggtgaattattcacgctcgcaa
tcagaagcggaggaaacagtggaaatgattcaaaaagctggcgggcaagccttcgccatc
caagcagatgtatccaaaaacagcgacgtgcaggatatgattcaagcaatcgtgaacaca
cacggcacggttgatattttagtcaacaatgccagcattacacggcatattccaatggat
gatcttgaggctgcgacagaagacgtctag

DBGET integrated database retrieval system