KEGG   Bacillus subtilis subsp. subtilis 168: BSU32920Help
Entry
BSU32920          CDS       T00010                                 

Gene name
yusT
Definition
(RefSeq) HTH-type transcriptional regulator YusT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-GeneID: 938601
NCBI-ProteinID: NP_391171
Pasteur: BG14032
BSORF: BG14032
UniProt: O32186
Position
3377893..3378780
Genome map
AA seq 295 aa AA seqDB search
MESGDLRVFQMVAREGTITKAALQLGYVQSNVTARIQQLEAELGTTLFLRHNRGMTLSAS
GKLLLDYANKIIGLLDEASKALSSSAEPSGPLMIGCTQTTAAVRLPKLLASYYEEHPNVQ
LSLTTGHTQFLLDKVLRYELDGAFIGCECHHPELESYPAFEEEPVVVSAASVPDVEEAIT
KPILVYSTGCSYRETLEKWLRSVGVTQPVIMEFGTLEAIIGGVTAGLGISLLPRTVVQKH
EAEGSIRLYPLPEALSQMKTEFIVRKDSFISSALRTFMDSFTPVKTAESQKSSLL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcggagatttacgtgtgtttcaaatggtagctcgtgaagggaccattacgaaa
gcagccctgcagcttggctatgtacaatcgaatgtcacggccagaattcaacaattggaa
gctgagctgggtaccacactgtttttgcgccataatcggggcatgacactttctgcaagc
ggaaaattgctgctggactacgcaaataaaattataggccttcttgatgaagcgtctaaa
gcgctctcatcctccgcagaaccaagcgggccgcttatgatcggctgcactcagacaacc
gccgcggtaaggcttccaaagcttctggcatcttattatgaagaacatccaaacgtccag
ctgtctttaacaacaggacatacgcaatttctccttgataaagttcttcgttatgaattg
gatggcgcgtttatcggatgcgaatgccatcatcctgagctcgaatcctatcctgcgttt
gaggaagaaccagtagttgtttcggctgcctccgtgcccgatgttgaggaagccatcaca
aagccgattctcgtttacagcacaggctgttcgtatcgagaaacacttgaaaaatggctg
cgttccgtcggtgtcacacagccggtcattatggaatttgggacgcttgaagcaattatc
ggcggggttacagcaggtcttggcatctcgttgctgccaagaacggttgtgcagaaacat
gaagcagaaggatcaattcgattgtacccgctgcctgaagctctcagccagatgaaaaca
gagtttattgttcgaaaagattcgtttatcagcagcgcgctgagaacctttatggattcc
tttacgccagttaaaacggctgaatcacaaaaaagcagtctgctataa

DBGET integrated database retrieval system