KEGG   Bacillus subtilis subsp. subtilis 168: BSU32930Help
Entry
BSU32930          CDS       T00010                                 

Gene name
yusU
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2573 DUF3106
Motif
Other DBs
NCBI-GeneID: 935925
NCBI-ProteinID: NP_391172
Pasteur: BG14033
BSORF: BG14033
UniProt: O32187
Position
complement(3378800..3379087)
Genome map
AA seq 95 aa AA seqDB search
MRKLLAVFSKGRWKMEQKLQEQLDGLLEKYTELLLGETNDELKEEVKQWILYTHIAKSMP
PLAKHWNATYPDAKQGIKEIIQHIKELNEAHRNKQ
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaagctccttgctgttttttcgaaaggaagatggaaaatggaacaaaaacttcag
gagcagcttgatggattgctggagaagtatactgagcttctgcttggtgaaacaaacgat
gagctaaaagaagaagtgaagcaatggattttgtacacccatatagccaaaagcatgcct
ccgctcgctaagcattggaatgcgacataccccgacgcgaagcagggcattaaagagatc
attcagcatattaaggaattaaatgaagcgcatcgaaacaaacaatag

DBGET integrated database retrieval system