KEGG   Bacillus subtilis subsp. subtilis 168: BSU32950Help
Entry
BSU32950          CDS       T00010                                 

Gene name
yusW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YusW
Motif
Other DBs
NCBI-GeneID: 938599
NCBI-ProteinID: NP_391174
Pasteur: BG14035
BSORF: BG14035
UniProt: O32189
Position
complement(3380157..3380594)
Genome map
AA seq 145 aa AA seqDB search
MHLIRAAGAVCLAVVLIAGCRFNEDQHQAEGENTAVTQLKSVPYSNFSLRVSYGDGEHNR
YEGIYTKNGTQEKAEIQDKLSGVNQEGEEALDEMKMILSELSVTDQMAETEVIHSVLAAF
NLDSHYDHIDLKLKLKDGSIREIKK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcatttgatcagagcagccggggctgtatgtctcgcagtggttctgattgcgggctgc
cgtttcaatgaagaccagcatcaggcagaaggagaaaatacagccgtcacccagctgaag
tccgttccctacagtaatttttcgcttcgtgtgagctacggggatggtgagcataaccgt
tatgaaggaatctatacaaagaacgggactcaggaaaaagcggaaatacaggataagctc
tccggtgtcaatcaggaaggagaagaagcgttagatgagatgaaaatgattttgagcgag
ctttccgtgacagaccaaatggctgaaacagaagtgatacacagtgtgctggcagcattt
aatctggacagtcattatgatcatatcgatttaaaattgaagctgaaggacggctccatc
agagaaatcaagaagtaa

DBGET integrated database retrieval system