KEGG   Bacillus subtilis subsp. subtilis 168: BSU32980Help
Entry
BSU32980          CDS       T00010                                 

Gene name
yusZ
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 Eno-Rase_NADH_b ADH_zinc_N F420_oxidored Methyltransf_3
Motif
Other DBs
NCBI-GeneID: 938596
NCBI-ProteinID: NP_391177
Pasteur: BG10863
BSORF: BG10863
UniProt: P37959
Position
3382633..3383475
Genome map
AA seq 280 aa AA seqDB search
MNKKIAIVTGASSGFGLLAAVKLARSFFVIATSRQPEKAEQLRELAAAHNVSDSIHITAL
DVTDEQSIVSFGKAVSAYAPIDLLVNNAGTAYGGFIEDVPMEHFRQQFETNVFGVIHVTK
TVLPYIRKHGGAKIINVSSISGLTGFPALSPYVSSKHALEGFSESLRIELLPFGIETALI
EPGSYKTSIWSTSLSNFMSVPADDSAYHQYYKKILSYVQKNGEESGDPQEVADLIYQLAT
KQHIKNLRYPIGKGIKLTLLFRSLFPWSAWESILKKKLFS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaatagccatcgtgacaggagcgtccagcggcttcggtctgctggcagct
gtaaagcttgcccgatcatttttcgtgatagccacatcaagacagcctgaaaaagcggaa
cagcttcgagaattggctgcagcacacaatgtgtctgattctattcacattacagctctc
gatgtcaccgatgaacaatctatagtctcattcggaaaagctgttagtgcttacgccccg
atcgatttactcgttaacaacgccggaacggcttatggaggatttatcgaggatgtgccg
atggaacatttcagacaacaatttgaaacgaatgtcttcggtgtgatccatgtgacaaaa
accgtgctgccttacataagaaagcatggcggcgcaaagattataaacgtgagcagcatc
agcggactgacaggattcccagcgctgtcgccatatgtttcttccaagcatgcattggaa
ggtttttctgaaagcctgcgtatcgagctgcttccgttcggtatcgaaaccgctttgatc
gagccgggctcatacaagacatcgatctggtcaacgtcattatcaaattttatgtcggtg
cctgctgacgattcagcctatcatcaatactataaaaagatcctttcctatgttcaaaaa
aacggagaagaaagcggagatccccaagaggttgccgacctcatttatcaattggcaaca
aaacagcacataaagaatttgcgatacccgatcggaaagggcatcaagctcaccctgctg
ttccgatcgctttttccttggtctgcgtgggagtctatcctgaagaaaaagctattcagc
tga

DBGET integrated database retrieval system