KEGG   Bacillus subtilis subsp. subtilis 168: BSU32990Help
Entry
BSU32990          CDS       T00010                                 

Gene name
mrgA
Definition
(RefSeq) metalloregulation DNA-binding stress protein
  KO
K04047  starvation-inducible DNA-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU32990 (mrgA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    BSU32990 (mrgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferritin
Motif
Other DBs
NCBI-GeneID: 938592
NCBI-ProteinID: NP_391178
Pasteur: BG10864
BSORF: BG10864
UniProt: P37960
Structure
PDB: 

Position
3383565..3384026
Genome map
AA seq 153 aa AA seqDB search
MKTENAKTNQTLVENSLNTQLSNWFLLYSKLHRFHWYVKGPHFFTLHEKFEELYDHAAET
VDTIAERLLAIGGQPVATVKEYTEHASITDGGNETSASEMVQALVNDYKQISSESKFVIG
LAEENQDNATADLFVGLIEEVEKQVWMLSSYLG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgaaaacgcaaaaacaaatcaaacattagttgagaattcactgaacacacaa
ttatcaaactggtttcttttatactctaagctccaccgtttccattggtatgtgaaaggg
cctcatttctttacattgcacgagaaatttgaagaactttatgaccatgcggctgaaaca
gtggataccatcgctgagcgcctgctggcgattggcggacagcctgttgccacagtgaaa
gaatacactgagcatgcatctatcacagacggcggaaacgaaacatcagcatcagaaatg
gtacaagcattggtaaacgactacaaacaaatcagcagcgaatctaaattcgtgatcggc
ctggctgaagaaaatcaagacaatgcgacagcggacttgtttgtcggattaattgaagaa
gttgaaaaacaagtgtggatgctttcctcttatttagggtaa

DBGET integrated database retrieval system