KEGG   Bacillus subtilis subsp. subtilis 168: BSU33010
Entry
BSU33010          CDS       T00010                                 

Gene name
cssR
Definition
(RefSeq) transcriptional regulatory protein CssR
  KO
K07770  two-component system, OmpR family, response regulator CssR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU33010 (cssR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU33010 (cssR)
Two-component system [BR:bsu02022]
 OmpR family
  CssS-CssR (secretion stress response)
   BSU33010 (cssR)
SSDB
Motif
Pfam: Response_reg Trans_reg_C DDRGK
Other DBs
NCBI-GeneID: 938594
NCBI-ProteinID: NP_391181
Pasteur: BG14131
BSORF: BG14131
UniProt: O32192 A0A6M3ZKR2
Position
3385724..3386401
AA seq 225 aa
MSYTIYLVEDEDNLNELLTKYLENEGWNITSFTKGEDARKKMTPSPHLWILDIMLPDTDG
YTLIKEIKAKDPDVPVIFISARDADIDRVLGLELGSNDYISKPFLPRELIIRVQKLLQLV
YKEAPPVQKNEIAVSSYRVAEDAREVYDENGNIINLTSKEFDLLLLFIHHKGHPYSREDI
LLKVWGHDYFGTDRVVDDLVRRLRRKMPELKVETIYGFGYRMMSS
NT seq 678 nt   +upstreamnt  +downstreamnt
ttgtcatacaccatttatctagttgaagatgaggataacctgaatgaactgctgacgaag
tatttagagaatgagggctggaacattacatcttttacgaaaggtgaagacgccagaaag
aaaatgacaccgtctccccacctatggattctcgatatcatgctgccggataccgacggc
tatacattaataaaagaaatcaaggcgaaagatcctgacgtgccggtcatttttatttcc
gcccgagatgcggatattgacagagtgcttggcttagagcttggcagcaatgactacatt
tcaaagccgtttttgccgcgggagctgattatccgtgtgcaaaagctgctgcagctcgta
tataaggaagctcctcctgtccaaaaaaatgaaattgccgtctcctcgtatcgggtcgct
gaagacgcccgcgaggtctatgacgaaaacgggaatatcatcaatttgacgtcaaaggaa
tttgatctgctgctattatttatccatcataaagggcatccatactctcgtgaggatatc
ctcctaaaagtgtggggacatgactacttcggaacagaccgggtcgttgatgatctcgtc
cggagactgcgcagaaagatgcctgaattgaaggtggagacgatttacggtttcggctac
aggatgatgtcatcatga

DBGET integrated database retrieval system