KEGG   Bacillus subtilis subsp. subtilis 168: BSU33020Help
Entry
BSU33020          CDS       T00010                                 

Gene name
cssS
Definition
(RefSeq) sensor histidine kinase
  KO
K07650  two-component system, OmpR family, sensor histidine kinase CssS [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Module
bsu_M00448  CssS-CssR (secretion stress response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU33020 (cssS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU33020 (cssS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU33020 (cssS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU33020 (cssS)
Protein kinases [BR:bsu01001]
 Histidine kinases
  OmpR family
   BSU33020 (cssS)
Two-component system [BR:bsu02022]
 OmpR family
  CssS-CssR [MD:M00448]
   BSU33020 (cssS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_5 HATPase_c_2 NrsF
Motif
Other DBs
NCBI-GeneID: 935936
NCBI-ProteinID: NP_391182
Pasteur: BG14132
BSORF: BG14132
UniProt: O32193
Position
3386398..3387753
Genome map
AA seq 451 aa AA seqDB search
MKNKPLAFQIWVVISGILLAISILLLVLFSNTLRDFFTNETYTTIENEQHVLTEYRLPGS
IERRYYSEEATAPTTVRSVQHVLLPENEEASSDKDLSILSSSFIHKVYKLADKQEAKKKR
YSADVNGEKVFFVIKKGLSVNGQSAMMLSYALDSYRDDLAYTLFKQLLFIIAVVILLSWI
PAIWLAKYLSRPLVSFEKHVKRISEQDWDDPVKVDRKDEIGKLGHTIEEMRQKLVQKDET
ERTLLQNISHDLKTPVMVIRGYTQSIKDGIFPKGDLENTVDVIECEALKLEKKIKDLLYL
TKLDYLAKQKVQHDMFSIVEVTEEVIERLKWARKELSWEIDVEEDILMPGDPEQWNKLLE
NILENQIRYAETKIEISMKQDDRNIVITIKNDGPHIEDEMLSSLYEPFNKGKKGEFGIGL
SIVKRILTLHKASISIENDKTGVTYRIAVPK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaagccgctcgcgtttcagatatgggttgtcatatccggcatcctgttagcg
atatcgattttactgcttgtgttattttcaaacacgctgcgagattttttcactaatgaa
acgtatacgacgattgaaaatgagcagcatgttctgacagagtaccgcctgccaggttcg
attgaaaggcgctattacagcgaggaagcgacggcgccgacaactgtccgctccgtacag
cacgtgctccttcctgaaaatgaagaggcttcttcagacaaggatttaagcattctgtca
tcttcatttatccacaaggtgtacaagctggctgataagcaggaagctaaaaagaaacgt
tacagcgccgacgtcaatggagagaaagtgttttttgtcattaaaaagggactttccgtc
aatggacaatcagcgatgatgctctcttacgcgcttgattcttatcgggacgatttggcc
tataccttgttcaaacagcttctgtttattatagctgtcgtcattttattaagctggatt
ccggctatttggcttgcaaagtatttatcaaggcctcttgtatcatttgaaaaacacgtc
aaacggatttctgaacaggattgggatgacccagtaaaagtggaccggaaagatgaaatc
ggcaaattgggccataccatcgaagagatgcgccaaaagcttgtgcaaaaggatgaaaca
gaaagaactctattgcaaaatatctctcatgatttaaaaacgccggtcatggtcatcaga
ggctatacacaatcaattaaagacgggatttttcctaaaggagaccttgaaaacactgta
gatgttattgaatgcgaagctcttaagctggagaaaaaaataaaggatttattatattta
acgaagctggattatttagcgaagcaaaaagtgcagcacgacatgttcagtattgtggaa
gtgacagaagaagtcatcgaacgattgaagtgggcgcggaaagaactatcgtgggaaatt
gatgtagaagaggatattttgatgccgggcgatccggagcaatggaacaaactcctcgaa
aacattttggaaaatcaaatccgctatgctgagacaaaaatagaaatcagcatgaaacaa
gatgatcgaaatatcgtgatcaccattaaaaatgacggtccgcatattgaagatgagatg
ctctccagcctctatgagccttttaataaagggaagaaaggcgaattcggcattggtcta
agcatcgtaaaacgaattttaactcttcataaggcatctatctcaattgaaaatgacaaa
acgggtgtaacataccgcatagcagtgccaaaatag

DBGET integrated database retrieval system