KEGG   Bacillus subtilis subsp. subtilis 168: BSU33029Help
Entry
BSU33029          CDS       T00010                                 

Gene name
yuzO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_7C DUF4033 DUF4478
Motif
Other DBs
NCBI-GeneID: 8303202
NCBI-ProteinID: YP_003097785
UniProt: O32302
Position
complement(3387781..3387945)
Genome map
AA seq 54 aa AA seqDB search
MRELDEMISRLRNRGIKVEKVKYPKQTLSEKKWVHQCKQPLKTNYRDFNGYSFT
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgagagaattggacgaaatgatcagccgcttgcgaaacagaggaatcaaagtggagaaa
gtcaaatatccgaagcagaccttgtcagagaaaaaatgggttcatcaatgcaaacagccg
ctcaaaacaaattacagagattttaacggctattctttcacataa

DBGET integrated database retrieval system