KEGG   Bacillus subtilis subsp. subtilis 168: BSU33030Help
Entry
BSU33030          CDS       T00010                                 

Gene name
yuxN
Definition
(RefSeq) HTH-type transcriptional regulator YuxN
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N HTH_Tnp_1_2
Motif
Other DBs
NCBI-GeneID: 935945
NCBI-ProteinID: NP_391183
Pasteur: BG11072
BSORF: BG11072
UniProt: P40950
Position
3388113..3388988
Genome map
AA seq 291 aa AA seqDB search
MKEKEKLIIETALKLFAQKGYNSTSVQEIAKECKISKGAFYIYFPSKEALLLSMLNYYYD
KTFTRILNIKTKGDSPRTAYRKQLTVLYENILEHKDFISMQLKEGSLPYTEEVEQCAKKI
RQSSLQFHIDSLLNIYGKKAEPYTAELCFLIEGISQIYLECMILLGYTVKPSQLADIIMN
RIDDMVKGMSERNDKPFITLEEASSLFGPLTHGRPDPLTESIVKSLRDKINSLNTNSSLE
LSESLDILEAEMKKKTPKLAIIKGMIHNLTESEALAKDAEQLKYLLKQQHI
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggaaaaagaaaaactgattattgaaacagccttaaaactatttgcccaaaaagga
tacaactcaacatcagtccaggaaatcgcaaaagaatgcaaaatatctaaaggcgctttt
tatatttattttccttcgaaagaagcgcttcttctctctatgctgaactactattatgat
aaaacgtttacccgaattttaaatattaaaacgaagggcgacagccccagaacggcttac
cgtaaacagctgaccgtcctctatgaaaacattcttgaacacaaagattttatcagcatg
cagttgaaggagggttctctgccttacacagaagaagtggagcaatgcgcaaaaaaaatc
cgccagtcctcacttcaatttcatatcgacagcctgctgaacatctatggaaaaaaagcg
gaaccgtacactgctgagctttgttttttaatagagggcatcagccagatttacctggaa
tgcatgattttgctcgggtacactgtgaagccgtctcaattagctgatatcattatgaat
cgaattgatgatatggtaaaaggcatgtctgaacgaaacgataagcctttcatcacattg
gaagaggcgagctctttattcggacctcttacgcacggacggcctgacccgctgactgaa
tcaattgtgaaaagcctacgtgacaaaattaacagcttaaacacaaactcctctcttgaa
ttatcggagagcttggacatacttgaagcagaaatgaagaaaaaaacaccgaagctggcg
atcataaaaggaatgattcataatctgacggagtctgaagctctcgccaaagatgcggaa
cagcttaaatatttattaaaacagcaacatatttag

DBGET integrated database retrieval system