KEGG   Bacillus subtilis subsp. subtilis 168: BSU33040Help
Entry
BSU33040          CDS       T00010                                 

Gene name
fumC
Definition
(RefSeq) fumarate hydratase class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00020  Citrate cycle (TCA cycle)
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Module
bsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU33040 (fumC)
   00620 Pyruvate metabolism
    BSU33040 (fumC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     BSU33040 (fumC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 FumaraseC_C SpoIID
Motif
Other DBs
NCBI-GeneID: 938591
NCBI-ProteinID: NP_391184
Pasteur: BG10384
BSORF: BG10384
UniProt: P07343
Position
complement(3389024..3390412)
Genome map
AA seq 462 aa AA seqDB search
MEYRIERDTMGEVKVPADKFWGAQTQRSKENFKIGSEKMPMRVVKAFAILKRSTALANKR
LGNLDAEKAEAIAAVCDDVLKGKYDDNFPLVVWQTGSGTQSNMNMNEVVANRATALLKEK
NSDQTIHPNDDVNRSQSSNDTFPTAMHVAAVLAVYEQLVPALDQLRNTLDEKAKAYNDIV
KIGRTHLQDATPLTLGQEISGWVHMLDRSKEMILEATDKMRALAIGGTAVGTGINAHPEF
GELVSEEITKLTGQTFSSSPNKFHALTSHDEITYAHGALKALAADLMKIANDVRWLASGP
RCGIGEIVIPENEPGSSIMPGKVNPTQSEALTMIAAQIMGNDATIGFAASQGNFELNVFK
PVIIYNFLQSVQLLSDGMNSFHDKCAVGIEPNKETIQENLSNSLMLVTALNPHIGYENAA
KIAKLAHKEGLTLKEAALKLELLTEEQFNEMVKPEDMVKPKA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggaatacagaattgaacgagacaccatgggagaagtaaaagttcctgctgataaattt
tggggcgcccaaacacagcgaagcaaggagaactttaagatcggttctgaaaaaatgccg
atgcgtgttgtgaaggcgtttgcaattttaaaacgaagcactgctctagctaataaacgc
ctcggcaatctggacgctgaaaaagcagaagcgattgcagcggtttgtgatgatgtgctc
aaaggcaagtacgatgacaacttcccgcttgtcgtatggcagaccggaagcggcacacaa
agcaatatgaacatgaacgaagtggtagccaaccgtgcgactgctttattaaaagagaag
aactctgatcaaacgattcatccaaatgatgacgtgaaccgaagccaaagctcaaacgac
acattcccgactgcgatgcatgttgccgctgttttggctgtttacgagcagcttgtgccg
gcgcttgatcagcttcgcaatacactggatgaaaaagcaaaagcatacaatgatattgtc
aaaatcggacgcacgcatcttcaggatgctacgccactgaccctcggacaggaaatcagc
ggatgggttcacatgctggaccgttcgaaggaaatgattttggaagcgacagataaaatg
cgtgcgcttgcaattggtggaacggctgtcggaacgggtatcaacgcccacccagagttt
ggagagcttgtctcagaagagatcactaagctgaccggccaaacgttcagcagctcgccg
aataaattccacgcgctgacaagccatgacgaaatcacttatgcgcatggcgcattaaaa
gcgcttgcggctgacttaatgaaaatcgcgaacgatgtcagatggctcgcaagcggaccc
cgctgcggcatcggggagatcgtcattcctgaaaatgagccgggaagctctattatgcct
ggtaaagtcaatccgacacaaagcgaagcgttaacaatgatcgcagcgcaaatcatgggg
aacgatgcgacaatcggctttgcggcgagtcaggggaactttgaactgaacgtgtttaag
cctgttattatttacaacttcctgcaatctgtgcagctgctcagtgacggcatgaattca
ttccatgataaatgtgctgtcggtattgagcctaataaagaaaccattcaggaaaacctg
tcaaattcattaatgcttgttacggcgctgaacccgcatatcggttatgaaaacgcggcg
aaaatcgccaagcttgcccataaagagggattgacgctcaaagaagcagctttgaagctt
gaattgctgacagaggagcaatttaacgaaatggttaagccggaagacatggtaaaacca
aaggcgtaa

DBGET integrated database retrieval system