KEGG   Bacillus subtilis subsp. subtilis 168: BSU33049Help
Entry
BSU33049          CDS       T00010                                 

Gene name
yvzF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3970
Motif
Other DBs
NCBI-GeneID: 8303152
NCBI-ProteinID: YP_003097786
UniProt: C0H3R3
Position
complement(3390479..3390664)
Genome map
AA seq 61 aa AA seqDB search
MAQVRLAGKQEEIEQLIRSFEQHYDVSYTSKEYGRTNPKYKYSKDSRVYLELKLKSAKIE
K
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaggtaaggctagctggaaaacaagaagaaattgaacagctcattagatcattt
gaacagcattatgatgtctcttatacatcaaaggagtacggcaggacaaatccaaaatac
aaatattcaaaggattcccgcgtatatcttgaattaaaattaaaatctgccaagatcgaa
aaataa

DBGET integrated database retrieval system