KEGG   Bacillus subtilis subsp. subtilis 168: BSU33050Help
Entry
BSU33050          CDS       T00010                                 

Gene name
gerAA
Definition
(RefSeq) spore germination protein A1
  KO
K06288  spore germination protein AA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU33050 (gerAA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerA
Motif
Other DBs
NCBI-GeneID: 935953
NCBI-ProteinID: NP_391185
Pasteur: BG10385
BSORF: BG10385
UniProt: P07868
Position
3390782..3392230
Genome map
AA seq 482 aa AA seqDB search
MEQTEFKEYIHDNLALVLPKLKENDDLVKNKKMLANGLVFYYLYFSEMTDENKVSEAIKT
LIKDEETLTLDQVKKRLDQLDARPVETAKKTIESILNGNCAVFINGLDKAYILTTGKKKT
RSLTEPTTEKVVRGPKVAFVEDIDTNLALIRQRTSHPKLITKKIMIGENKLKPAAIMYIE
GKAKKSVIKEVKARLKNIQLEDIQDSGTLEELIEDNKYSPFPQIQNTERPDKVSSALFNG
RVAILVDSSPFVLLVPVSLGILMQSPDDYYERWISASLIRSLRFASIFITLFLSSIYITL
VSFHQGLLPTALAVTISANRENVPFPPIFEALLMEVTIELLREAGLRLPNPLGQTIGLVG
GVVIGQAAVEANLVSSILVIVVSVIALASFTVPQYGMGLSFRVLRFISMFSAAILGLYGI
ILFMLVVYTHLTRQTSFGSPYFSPNGFFSLKNTDDSIIRLPIKNKPKEVNNPNEPKTDST
ET
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
ttggaacaaacagagtttaaggaatatatacacgataatttagcattggtgctgccaaaa
ttaaaagaaaacgatgatctggtgaaaaacaaaaaaatgcttgcgaacggactggttttt
tactatctctatttcagtgaaatgactgatgagaataaggtgtcagaagccattaaaact
ttgattaaagatgaggagaccttaacgcttgaccaggtcaaaaaacgccttgaccagctt
gacgcaagacctgttgaaactgcaaaaaaaacgattgaatcgattctcaacggcaattgt
gctgtgtttatcaacggattggataaagcctatattctgaccacaggaaagaaaaaaaca
agaagcctgacagagccgacaactgaaaaagtggttcgcggcccaaaagtagcgtttgta
gaggatattgatacaaatctcgctctgatcagacaaagaacctctcatccgaaattgatc
accaaaaaaatcatgatcggcgaaaacaagctgaagcctgcagccattatgtacattgaa
ggcaaagcaaaaaagtccgtcataaaagaagtgaaggcgcggcttaaaaatatccagctg
gaagatatccaggacagcggaacgctcgaggagctcattgaagataataaatattcacca
tttccgcagatacaaaatacggaaagacctgacaaagtatcttcagccctgtttaacggc
cgtgtggcaattttggtcgacagttcaccatttgtgctgctggtgccggtttctctcggc
atcctgatgcaatccccggatgactactatgaacgctggatttcagcatctcttatccgg
tcgctgcgctttgcttctatctttatcaccttgtttttgtcatcgatttatataacactt
gtttccttccatcaggggctgctgccgaccgcactcgccgtcacgatttcggcgaacagg
gaaaacgtgccgttccctccgatatttgaagccctgctgatggaagtcaccatcgagctg
ctaagggaagccggactgcgactccccaatccgctcggacagacgatcggcctcgttggg
ggcgtagtcatcggacaggctgctgtagaagcgaatctcgtcagttcgattttggtcatt
gtcgtcagtgtcattgccctggcatcctttaccgttcctcaatacggaatgggtctgtct
ttccgggtgctgcgttttatttcgatgttttccgccgctattttagggctatacggcatt
attttatttatgcttgtcgtttatacgcacttaacgagacaaacgagctttgggtctccg
tatttttcgccaaacggattctttagcctgaaaaatacggatgactccattatccgtctc
ccaattaaaaacaaaccaaaagaggtgaataatccaaatgagccaaaaacagactccact
gaaacttaa

DBGET integrated database retrieval system