KEGG   Bacillus subtilis subsp. subtilis 168: BSU33050
Entry
BSU33050          CDS       T00010                                 

Symbol
gerAA
Name
(RefSeq) spore germination protein A1
  KO
K06288  spore germination protein AA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU33050 (gerAA)
SSDB
Motif
Pfam: GerA Dpy19
Other DBs
NCBI-GeneID: 935953
NCBI-ProteinID: NP_391185
Pasteur: BG10385
BSORF: BG10385
UniProt: P07868 A0A6M3ZG95
Position
3390782..3392230
AA seq 482 aa
MEQTEFKEYIHDNLALVLPKLKENDDLVKNKKMLANGLVFYYLYFSEMTDENKVSEAIKT
LIKDEETLTLDQVKKRLDQLDARPVETAKKTIESILNGNCAVFINGLDKAYILTTGKKKT
RSLTEPTTEKVVRGPKVAFVEDIDTNLALIRQRTSHPKLITKKIMIGENKLKPAAIMYIE
GKAKKSVIKEVKARLKNIQLEDIQDSGTLEELIEDNKYSPFPQIQNTERPDKVSSALFNG
RVAILVDSSPFVLLVPVSLGILMQSPDDYYERWISASLIRSLRFASIFITLFLSSIYITL
VSFHQGLLPTALAVTISANRENVPFPPIFEALLMEVTIELLREAGLRLPNPLGQTIGLVG
GVVIGQAAVEANLVSSILVIVVSVIALASFTVPQYGMGLSFRVLRFISMFSAAILGLYGI
ILFMLVVYTHLTRQTSFGSPYFSPNGFFSLKNTDDSIIRLPIKNKPKEVNNPNEPKTDST
ET
NT seq 1449 nt   +upstreamnt  +downstreamnt
ttggaacaaacagagtttaaggaatatatacacgataatttagcattggtgctgccaaaa
ttaaaagaaaacgatgatctggtgaaaaacaaaaaaatgcttgcgaacggactggttttt
tactatctctatttcagtgaaatgactgatgagaataaggtgtcagaagccattaaaact
ttgattaaagatgaggagaccttaacgcttgaccaggtcaaaaaacgccttgaccagctt
gacgcaagacctgttgaaactgcaaaaaaaacgattgaatcgattctcaacggcaattgt
gctgtgtttatcaacggattggataaagcctatattctgaccacaggaaagaaaaaaaca
agaagcctgacagagccgacaactgaaaaagtggttcgcggcccaaaagtagcgtttgta
gaggatattgatacaaatctcgctctgatcagacaaagaacctctcatccgaaattgatc
accaaaaaaatcatgatcggcgaaaacaagctgaagcctgcagccattatgtacattgaa
ggcaaagcaaaaaagtccgtcataaaagaagtgaaggcgcggcttaaaaatatccagctg
gaagatatccaggacagcggaacgctcgaggagctcattgaagataataaatattcacca
tttccgcagatacaaaatacggaaagacctgacaaagtatcttcagccctgtttaacggc
cgtgtggcaattttggtcgacagttcaccatttgtgctgctggtgccggtttctctcggc
atcctgatgcaatccccggatgactactatgaacgctggatttcagcatctcttatccgg
tcgctgcgctttgcttctatctttatcaccttgtttttgtcatcgatttatataacactt
gtttccttccatcaggggctgctgccgaccgcactcgccgtcacgatttcggcgaacagg
gaaaacgtgccgttccctccgatatttgaagccctgctgatggaagtcaccatcgagctg
ctaagggaagccggactgcgactccccaatccgctcggacagacgatcggcctcgttggg
ggcgtagtcatcggacaggctgctgtagaagcgaatctcgtcagttcgattttggtcatt
gtcgtcagtgtcattgccctggcatcctttaccgttcctcaatacggaatgggtctgtct
ttccgggtgctgcgttttatttcgatgttttccgccgctattttagggctatacggcatt
attttatttatgcttgtcgtttatacgcacttaacgagacaaacgagctttgggtctccg
tatttttcgccaaacggattctttagcctgaaaaatacggatgactccattatccgtctc
ccaattaaaaacaaaccaaaagaggtgaataatccaaatgagccaaaaacagactccact
gaaacttaa

DBGET integrated database retrieval system