KEGG   Bacillus subtilis subsp. subtilis 168: BSU33060
Entry
BSU33060          CDS       T00010                                 

Symbol
gerAB
Name
(RefSeq) spore germination protein A2
  KO
K06289  spore germination protein AB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33060 (gerAB)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU33060 (gerAB)
SSDB
Motif
Pfam: Spore_permease Trp_Tyr_perm
Other DBs
NCBI-GeneID: 935948
NCBI-ProteinID: NP_391186
Pasteur: BG10386
BSORF: BG10386
UniProt: P07869 A0A6M4JP29
Position
3392199..3393296
AA seq 365 aa
MSQKQTPLKLNTFQGISIVANTMLGAGLLTLPRALTTKANTPDGWITLILEGFIFIFFIY
LNTLIQKKHQYPSLFEYLKEGLGKWIGSIIGLLICGYFLGVASFETRAMAEMVKFFLLER
TPIQVIILTFICCGIYLMVGGLSDVSRLFPFYLTVTIIILLIVFGISFKIFDINNLRPVL
GEGLGPIANSLTVVSISFLGMEVMLFLPEHMKKKKYTFRYASLGFLIPIILYILTYIIVV
GALTAPEVKTLIWPTISLFQSFELKGIFIERFESFLLVVWIIQFFTTFVIYGYFAANGLK
KTFGLSTKTSMVIIGITVFYFSLWPDDANQVMMYSDYLGYIFVSLFLLPFILFFIVALKR
RITTK
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgagccaaaaacagactccactgaaacttaatacctttcaaggtatttctattgttgca
aatacaatgcttggggccggacttttaacattgccgcgagcgctgaccactaaggctaat
acgcctgacggctggatcacgctgatattagaaggtttcatttttattttcttcatttat
ttaaacacgctcattcagaaaaaacatcaatacccttcactctttgaatatttgaaggaa
gggcttgggaaatggatcggcagcatcatcggccttttgatctgcggctatttcctcggc
gtagccagcttcgagacacgggcaatggctgaaatggtgaagtttttcctgctggagaga
accccaattcaagtcattattttaacgtttatttgctgcggcatttatttaatggttggg
ggcttaagcgatgtgtcgcggctgtttcccttttatttaacggtaaccattattattttg
ctgattgtgttcgggatcagttttaaaatttttgatatcaataatttgcgtcctgtttta
ggcgaaggccttggacccattgcaaactcccttaccgtcgtttccatctcttttttagga
atggaagtgatgctgtttcttcctgaacatatgaagaaaaagaaatacacgttcagatat
gcgtctctaggatttctgattccgattatcttatatatccttacgtatattatcgttgtc
ggagctttgaccgctcccgaggtgaaaacgctgatttggccgactatttctctctttcag
tcctttgagcttaaaggcatatttattgaacggtttgaatcctttttactggtggtctgg
attatccagtttttcaccacatttgtcatttacggatactttgccgctaacgggctaaag
aagacatttggattatcgactaaaacaagcatggtgattatcggcataacggtcttttat
ttttctctctggccggatgacgccaatcaagtcatgatgtatagcgattatcttggctat
atttttgtctccctgtttctgcttccgttcattctctttttcattgtagctctcaagagg
aggattacaacaaaatga

DBGET integrated database retrieval system