KEGG   Bacillus subtilis subsp. subtilis 168: BSU33060Help
Entry
BSU33060          CDS       T00010                                 

Gene name
gerAB
Definition
(RefSeq) spore germination protein A2
  KO
K06289  spore germination protein AB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU33060 (gerAB)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU33060 (gerAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_permease Trp_Tyr_perm
Motif
Other DBs
NCBI-GeneID: 935948
NCBI-ProteinID: NP_391186
Pasteur: BG10386
BSORF: BG10386
UniProt: P07869
Position
3392199..3393296
Genome map
AA seq 365 aa AA seqDB search
MSQKQTPLKLNTFQGISIVANTMLGAGLLTLPRALTTKANTPDGWITLILEGFIFIFFIY
LNTLIQKKHQYPSLFEYLKEGLGKWIGSIIGLLICGYFLGVASFETRAMAEMVKFFLLER
TPIQVIILTFICCGIYLMVGGLSDVSRLFPFYLTVTIIILLIVFGISFKIFDINNLRPVL
GEGLGPIANSLTVVSISFLGMEVMLFLPEHMKKKKYTFRYASLGFLIPIILYILTYIIVV
GALTAPEVKTLIWPTISLFQSFELKGIFIERFESFLLVVWIIQFFTTFVIYGYFAANGLK
KTFGLSTKTSMVIIGITVFYFSLWPDDANQVMMYSDYLGYIFVSLFLLPFILFFIVALKR
RITTK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaaacagactccactgaaacttaatacctttcaaggtatttctattgttgca
aatacaatgcttggggccggacttttaacattgccgcgagcgctgaccactaaggctaat
acgcctgacggctggatcacgctgatattagaaggtttcatttttattttcttcatttat
ttaaacacgctcattcagaaaaaacatcaatacccttcactctttgaatatttgaaggaa
gggcttgggaaatggatcggcagcatcatcggccttttgatctgcggctatttcctcggc
gtagccagcttcgagacacgggcaatggctgaaatggtgaagtttttcctgctggagaga
accccaattcaagtcattattttaacgtttatttgctgcggcatttatttaatggttggg
ggcttaagcgatgtgtcgcggctgtttcccttttatttaacggtaaccattattattttg
ctgattgtgttcgggatcagttttaaaatttttgatatcaataatttgcgtcctgtttta
ggcgaaggccttggacccattgcaaactcccttaccgtcgtttccatctcttttttagga
atggaagtgatgctgtttcttcctgaacatatgaagaaaaagaaatacacgttcagatat
gcgtctctaggatttctgattccgattatcttatatatccttacgtatattatcgttgtc
ggagctttgaccgctcccgaggtgaaaacgctgatttggccgactatttctctctttcag
tcctttgagcttaaaggcatatttattgaacggtttgaatcctttttactggtggtctgg
attatccagtttttcaccacatttgtcatttacggatactttgccgctaacgggctaaag
aagacatttggattatcgactaaaacaagcatggtgattatcggcataacggtcttttat
ttttctctctggccggatgacgccaatcaagtcatgatgtatagcgattatcttggctat
atttttgtctccctgtttctgcttccgttcattctctttttcattgtagctctcaagagg
aggattacaacaaaatga

DBGET integrated database retrieval system